KEGG   Roseateles depolymerans: RD2015_2755Help
Entry
RD2015_2755       CDS       T04166                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
rdp  Roseateles depolymerans
Pathway
rdp00020  Citrate cycle (TCA cycle)
rdp00190  Oxidative phosphorylation
rdp00650  Butanoate metabolism
rdp01100  Metabolic pathways
rdp01110  Biosynthesis of secondary metabolites
rdp01120  Microbial metabolism in diverse environments
rdp01130  Biosynthesis of antibiotics
rdp01200  Carbon metabolism
Module
rdp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rdp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rdp_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rdp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RD2015_2755
   00650 Butanoate metabolism
    RD2015_2755
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RD2015_2755
Enzymes [BR:rdp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RD2015_2755
    1.3.5.4  fumarate reductase (quinol)
     RD2015_2755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4_16 Fer4_4 Fer4
Motif
Other DBs
NCBI-ProteinID: ALV07220
UniProt: A0A0U3MZ84
LinkDB All DBs
Position
complement(3246823..3247527)
Genome map
AA seq 234 aa AA seqDB search
MIKRTFEIYRYDPDKDAKPYIQTIELELAGNERMLLDALLKLKAVDPTLSFRRSCREGVC
GSDAMNINGKNGLACLTNLRSLPDVIKLKPLPGLPVVRDLIVDMTQFFKQYHSIKPFLLN
ETRPPEKERLQSPEERDELNGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIAD
SRDEGTAERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRAV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagcgcaccttcgagatttatcgctacgacccggacaaggacgccaagccctac
atccagaccatcgagctggagctggccggcaacgagcgcatgctgctggacgccctgctc
aagctcaaggccgtggacccgacgctgtccttccgccgctcctgccgtgaaggcgtgtgc
ggttcggacgcgatgaacatcaacggcaagaacggtctggcctgcctgaccaacctgcgt
tcgctgccggacgtcatcaagctcaagccgctgcccggtctgccggtggtccgcgacctg
atcgtggacatgacgcagttcttcaagcagtaccactcgatcaagccgttcctgctgaac
gaaacgcgcccgcccgagaaggagcgtctgcagtcgccggaagagcgcgatgagctcaac
ggcctgtacgagtgcatcctgtgcgccagctgctcgaccagctgccccagcttctggtgg
aatcccgacaagttcgtcggtcccgccggtctgctgcaggcctaccgcttcatcgccgac
agccgcgacgaaggcacggccgagcgtctggacaacctggaagacccgtaccgtctgttc
cgctgccacaccatcatgaactgcgtcgatgtctgccccaagggtctgaacccgacgaag
gccatcggcaagatcaaggaactgatggtgcgccgcgccgtctaa

DBGET integrated database retrieval system