KEGG   Roseateles depolymerans: RD2015_2756Help
Entry
RD2015_2756       CDS       T04166                                 

Definition
(GenBank) Succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rdp  Roseateles depolymerans
Pathway
rdp00020  Citrate cycle (TCA cycle)
rdp00190  Oxidative phosphorylation
rdp00650  Butanoate metabolism
rdp01100  Metabolic pathways
rdp01110  Biosynthesis of secondary metabolites
rdp01120  Microbial metabolism in diverse environments
rdp01130  Biosynthesis of antibiotics
rdp01200  Carbon metabolism
Module
rdp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rdp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rdp_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rdp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RD2015_2756
   00650 Butanoate metabolism
    RD2015_2756
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RD2015_2756
Enzymes [BR:rdp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RD2015_2756
    1.3.5.4  fumarate reductase (quinol)
     RD2015_2756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO FAD_binding_3 HI0933_like GIDA
Motif
Other DBs
NCBI-ProteinID: ALV07221
UniProt: A0A0U3E227
LinkDB All DBs
Position
complement(3247545..3249350)
Genome map
AA seq 601 aa AA seqDB search
MQIGTSLPKRKFDVVIVGAGGSGMRASLQLSLAGLNVAVLSKVFPTRSHTVAAQGGIGAS
LGNMSEDNWHYHFYDTVKGSDWLGDQDAIEFMCREAPKVVYELEHFGMPFDRNPDGTIYQ
RPFGGHTANYGEKPVQRACAAADRTGHAMLHTLYQQNVKARTNFFVEWMALDLIRDADGD
VVGVTALEMETGEIHILEAKTVLLATGGAGRIFAASTNAFINTGDGLGMAARADIPLQDM
EFWQFHPTGVAGAGVLLTEGCRGEGAILRNANGERFMERYAPTLKDLAPRDFVSRCMDQE
IKEGRGCGPNKDYVVLDMTHLGGDTIMKRLPSVFEIGHNFANVDITKEPIPVVPTIHYQM
GGIPTNIHGQVVVPKGDDYKSVVNGLYAVGECSCVSVHGANRLGTNSLLDLLVFGRAAGN
HIVDAHKKGVSHKPLPKDAADQTLARLNRLESNSGGEYAQDVANDLRTAMQSHAGVFRTQ
AMLDEGVGAIAAIRERVKNITLKDKSKVFNTARVEALEVDNLIEAAQATIVSAAARKECR
GAHTVNDYERGADDAEFPLGRNDKEWMKHTLWHSASNSLTYKPVNLQPLTVESVPPKVRT
F
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcggaacctcgctccccaagcgcaagttcgacgtcgtcatcgttggagccggc
ggctctggcatgcgcgcttcgctgcaactgtcgctcgccggcctgaatgtggccgtgctg
tccaaggtgttcccgacccgctcccacaccgtggcagcgcagggcggcatcggcgccagc
ctgggcaacatgtcggaagacaactggcactaccacttctacgacaccgtcaagggctcg
gactggctgggtgaccaggacgccatcgagttcatgtgccgtgaagccccgaaggtggtg
tacgagctcgaacacttcggcatgccgttcgaccgcaaccccgacggcaccatctaccag
cgtccgttcggcggccacaccgccaactacggtgaaaagccggtgcaacgcgcctgcgct
gcggccgaccgtaccggccacgcgatgctgcacacgctgtaccagcagaacgtcaaggcc
cgcaccaacttcttcgtggagtggatggccctggacctgatccgcgacgccgacggcgac
gtggtgggcgtgaccgcgctggaaatggaaaccggcgagatccacatcctcgaagccaag
accgtgctgctggcgaccggtggtgccggccgcatcttcgccgcctccaccaacgccttc
atcaacaccggtgacggcctgggcatggccgcccgtgcggacatcccgctgcaggacatg
gagttctggcagttccacccgaccggcgtggccggcgcgggcgtgctgctgaccgaaggc
tgccgcggcgaaggcgccatcctgcgcaacgccaacggcgagcgcttcatggagcgttac
gcccccacgctgaaggatctggccccgcgtgacttcgtctcgcgctgcatggaccaggaa
atcaaggaaggtcgcggctgtggtcccaacaaggactacgtcgtgctggacatgacccac
ctgggtggcgacaccatcatgaagcggctgccctcggtcttcgagatcggccacaacttc
gccaacgtggacatcaccaaggaaccgatcccggtggtgccgaccattcactaccagatg
ggtggcatccccaccaacatccatggccaggtggtggtccccaagggcgacgactacaag
agcgtggtcaacggtctgtatgccgtgggcgaatgctcctgcgtgtcggtgcacggcgcc
aaccgcctgggcacgaactcgctgctggacctgctggtgttcggccgtgccgccggcaac
cacatcgtggacgcgcacaagaagggcgtctcgcacaagccgctgcccaaggacgctgcc
gaccagaccctggctcgcctgaaccgtctggaaagcaacagcggcggtgaatacgcccag
gacgtcgccaacgacctgcgcaccgccatgcagtcccacgccggtgtgttccgcacccag
gccatgctggacgaaggggtcggcgccatcgccgccatccgcgagcgggtgaagaacatc
accctgaaggacaagtccaaggtgttcaacaccgcccgcgtggaagcgctggaagtggac
aacctgatcgaggcggcccaagccaccatcgtctccgccgcagcccgcaaggaatgccgt
ggcgcccacaccgtgaacgactacgagcgtggtgccgacgatgcggaattcccgctgggc
cgcaatgacaaggaatggatgaagcacacgctgtggcacagcgccagcaacagcctgacc
tacaagccggtcaaccttcagccgctgaccgttgaaagcgtgcccccgaaggttcgtacc
ttctaa

DBGET integrated database retrieval system