KEGG   Roseateles depolymerans: RD2015_2913Help
Entry
RD2015_2913       CDS       T04166                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rdp  Roseateles depolymerans
Pathway
rdp00061  Fatty acid biosynthesis
rdp00780  Biotin metabolism
rdp01100  Metabolic pathways
rdp01130  Biosynthesis of antibiotics
rdp01212  Fatty acid metabolism
Module
rdp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rdp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RD2015_2913
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RD2015_2913
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    RD2015_2913
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rdp01004]
    RD2015_2913
Enzymes [BR:rdp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     RD2015_2913
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     RD2015_2913
Lipid biosynthesis proteins [BR:rdp01004]
 Fatty acid synthase
  Component type
   RD2015_2913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ALV07375
UniProt: A0A0U3LH04
LinkDB All DBs
Position
3420709..3421491
Genome map
AA seq 260 aa AA seqDB search
MGFLAGKRLLITGVLSNRSIAYGIAKACHREGAELAFSYVGERFKDRITEFAAEFGSSLV
FDCDVGDDAQIDRMFAQLGEHWPEFDGFVHSIGFAPREAIAGDFLDGLSRENFRIAHDIS
AYSFPAMAKAAQARLRPGSALLTLSYLGAERFVPNYNTMGLAKASLEASVRYLAYNLGAK
NIRVNGISAGPIKTLAASGIKDFGKLLNQFAATTAIRRNVTIDDVGNTAAFLLSDLSAGI
SSEIIYVDGGFSHSALAGTE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggatttctcgctggcaagcgactgttgatcacgggcgtgctgtccaaccgttccatc
gcctacggcatcgccaaggcctgccatcgcgaaggggctgaactggccttcagctatgtc
ggtgagcgcttcaaagaccgcatcaccgagtttgccgccgaattcggctcctcgctggtc
ttcgactgcgacgtcggcgacgatgcccagatcgaccgcatgttcgcccaactcggcgag
cactggccggaattcgacggctttgtccactccatcggcttcgcaccgcgtgaagccatt
gcgggcgacttcctggacggcctgtcgcgcgaaaacttccgcatcgcccacgacatctcc
gcctacagcttcccggccatggccaaggcggcccaggcccgcctgcgtccgggctctgcc
ctgctgaccctgtcctacctgggcgccgagcgctttgtgcccaactacaacaccatgggc
ctggccaaggcgtcgctggaagccagcgtccgttacctggcctacaacctgggggcgaag
aacatccgcgtcaacggcatctcggccggcccgatcaaaaccctggcagcctccggcatc
aaggatttcggcaagctgctgaaccagttcgccgccaccaccgccatccgccgcaatgtc
accattgacgacgtgggcaataccgctgcgttcctgctgtcggacctgtccgctggcatc
agctcggaaatcatctacgtggacggcggtttcagccacagcgcgctggcaggcaccgaa
taa

DBGET integrated database retrieval system