KEGG   Roseateles depolymerans: RD2015_2917Help
Entry
RD2015_2917       CDS       T04166                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rdp  Roseateles depolymerans
Brite
Enzymes [BR:rdp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RD2015_2917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ALV07379
UniProt: A0A0U3MWH7
LinkDB All DBs
Position
3426055..3426585
Genome map
AA seq 176 aa AA seqDB search
MKTRHWLATSLLALCPLVGAFAAETTVTLKIATPQGDGESVGTVRIVETRYGLVFYPQLT
NLPAGLHGFHVHANPSCAPGMKDGNPVPADGAGGHMDPDKSGRHGEPWGEGHLGDLPALY
VDPQGNATNPVLAPRLMRLLDVRKHALMVHAGGDNHADHPAPLGGGGPRIACGVIE
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaagactcgccactggctggccacgtccctgctcgccctgtgtcccctcgtgggcgct
tttgcggcggaaaccaccgtcacgctcaagatcgccacgccgcaaggcgacggcgaatcg
gtcggcaccgtccgcatcgtcgagacccgctacggtctggtgttctatccgcaactcacc
aatctgccggccggcctgcatggtttccacgtccatgcgaatccttcctgcgcacccggc
atgaaagacggcaatcctgtcccggcggatggcgccggcggtcacatggacccggacaaa
agcggccgccacggcgaaccctggggcgaaggccatctcggcgacctgccggccctgtat
gtggacccgcaaggcaacgccaccaacccggtcctggccccgcgcctgatgcgcctgctg
gatgtgcgcaaacacgccctgatggtccatgccggcggcgacaaccatgccgatcacccg
gccccgctgggcggtggcggcccccgcatcgcctgcggcgtcatcgaataa

DBGET integrated database retrieval system