KEGG   Roseateles depolymerans: RD2015_4513Help
Entry
RD2015_4513       CDS       T04166                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
rdp  Roseateles depolymerans
Brite
KEGG Orthology (KO) [BR:rdp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rdp01002]
    RD2015_4513
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rdp04147]
    RD2015_4513
   04090 CD molecules [BR:rdp04090]
    RD2015_4513
Enzymes [BR:rdp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     RD2015_4513
Peptidases [BR:rdp01002]
 Metallo Peptidases
  Family M2
   RD2015_4513
Exosome [BR:rdp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RD2015_4513
CD molecules [BR:rdp04090]
 Proteins
  RD2015_4513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ALV08954
UniProt: A0A0U3MX49
LinkDB All DBs
Position
complement(5285169..5287085)
Genome map
AA seq 638 aa AA seqDB search
MKRSISNARLSRLALATVLGATALAAGAATPADAAAPTSQAATPVKAGKTAKAARSAPTR
QEAERFVKDAESRLEALLIKSQRNEWVAENFITDDTQQITAEANEELLKATGELALAARR
YNGLTLPADTARKLKLMQLTMMIPDDQERARFTRLATRMTSAYGTAKYCPQQHGDTKPAC
LALDDLEKIMAESRDPAQLEDAWVGWHAQSRAYKQDYVDYVALSNKGSRAMGFADTGALW
RSGYDMTPDAFSADMARVWQQVRPLYESLHTYVRYKLRQTYGPDQVPATGPIPAHLLGNM
WSQSWENIYPLVKPAAKAGDYDLSQVLVQRGTSAKEMVKYAEGFYTSLGMETLPETFWER
SLLTKPQDREVVCHASAWDIDQQQDVRVKMCIRPTEEDFITIHHELGHIYYDLAYRHQPT
LFRNGANDGFHEAIGDTVALSITPDYLKRLGLMKDTDRPGDDIDNLLMQALRKVAFLPFA
YKVDAWRWQVYGGQVQPQDYDKVWWSLSETYQGISRPVPMQEGGFDAGAKFHVAADVAYA
RYFVAHLLQFQFQRALCREAGYTGPLHSCSIFGNKKAGEKYQAMLKLGASKPWPQALQAM
TGEQQLDGSALIEYFQPLKVWLDQQNAQLAKSDAVLKR
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatcgatttccaacgcccgcctgtcccggctggcgctcgccaccgtcctgggc
gccaccgctctggcggctggtgccgccacaccggccgatgcggccgcgccgaccagccag
gcggcgacccccgtcaaggcgggcaagacggccaaggcggcccgatccgcaccgacccgg
caagaggccgagcgcttcgtcaaggacgccgaatctcgcctggaagcgctgctgattaag
tcgcagcgcaatgaatgggtggcggagaacttcatcaccgacgacacccagcagatcacc
gctgaggcgaacgaagaactgctcaaggccaccggcgaactggccctggccgcccgccgc
tacaacggcctgacgctgccggccgacacggcccgcaagctcaagctgatgcagctgacg
atgatgattccggacgaccaggagcgcgcccgcttcacccgtctggccacccgcatgacc
agtgcttacggcacggccaaatactgcccgcagcagcacggcgacaccaaaccggcctgc
ctggcgctggacgatctggaaaagatcatggccgagagccgtgacccggcccagctcgag
gacgcctgggtgggctggcatgcccagtcccgtgcctacaagcaggactacgtggattac
gtggccctgtccaacaagggctcgcgagcgatgggcttcgccgacaccggcgccctgtgg
cgctcgggctatgacatgacgccggacgccttctccgccgacatggcccgtgtgtggcag
caggtgcgtccgctgtatgagtcgctgcacacctacgtgcgctacaagctgcgccagacc
tacggcccggaccaggtgcccgccaccggcccgatcccggcgcatctgctgggcaacatg
tggagccagagctgggagaacatctatcccctggtcaagccggccgccaaggcgggggac
tatgacctgagccaggtgctggtgcagcgcggcacctccgccaaggagatggtgaagtat
gcggagggcttctacacctcgctgggcatggagaccctgcccgagacgttctgggagcgc
tcgctgctgaccaagccgcaggaccgggaagtggtctgccatgcgtcggcctgggacatt
gaccagcagcaggatgtgcgggtgaagatgtgcatccgtccgacggaagaggacttcatc
accatccatcacgaactgggccacatctactacgacctggcttaccggcatcaacccacc
ctgttccgcaacggcgccaatgacgggttccatgaagccattggcgacacggtggccttg
tccatcacgccggactacctcaagcgcctgggcttgatgaaggacaccgaccgccccggc
gacgacatcgacaacctgctgatgcaggcgctgcgcaaggtggccttcctgcctttcgcc
tacaaggtggatgcatggcgctggcaggtctatggcggccaggtgcagccgcaggactac
gacaaggtgtggtggtcgctgagcgagacctaccagggcatttcgcgcccggtgccgatg
caggagggcggctttgatgccggtgccaagttccacgtcgcggccgatgtggcctatgcg
cggtatttcgtggcccacctgttgcagttccagttccagcgcgccctgtgccgcgaggcg
ggttataccgggccgctgcacagctgctcgatcttcggcaacaagaaggcgggcgagaaa
taccaggccatgctgaagctgggcgccagcaagccctggccgcaggcgctgcaggcgatg
accggtgagcagcagctcgacggcagcgcgctgatcgagtatttccagccgctcaaggtg
tggttggatcagcagaacgcgcagctggccaagagcgacgcggtgctcaagcgctga

DBGET integrated database retrieval system