KEGG   Roseateles depolymerans: RD2015_4699Help
Entry
RD2015_4699       CDS       T04166                                 

Definition
(GenBank) Putative serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rdp  Roseateles depolymerans
Brite
KEGG Orthology (KO) [BR:rdp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rdp01001]
    RD2015_4699
Enzymes [BR:rdp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     RD2015_4699
Protein kinases [BR:rdp01001]
 Serine/threonine kinases: Other
  Bacterial family
   RD2015_4699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: ALV09139
UniProt: A0A0U3N1H0
LinkDB All DBs
Position
complement(5511480..5512607)
Genome map
AA seq 375 aa AA seqDB search
MTAAGFFKRLLGRSLPPPAVEDLPSALQTTQPMPRWAGSRLDNYELGQEIGRGAMAKVHQ
AVDRRSGGSVAIKRLSLQREFAPEDLVDVRERFIREASAALHLTHPDILRVLDAGESGGD
TWIAMELVVGHDLSHYTRESQRLPLREVLLLGARLARALHYAHSHGVVHRDIKPANVMLD
RPTGSVKIMDFGIARVADGSRTRTGLVLGTPSYMSPEQLAGLKVDGRSDLYSLGVMLFQL
LTGHLPHQSESMASLMHQIANQPPPDVRLYRQELPESLAMVVALSLEKRPELRYQSGEQL
AQDLEAVLADLPVGLANSRGDVSASPAGGSAKRTDEGDPTTTPPTAGLAFEETLRLRSSA
AVHNHPPPDDPARKT
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctgcagggttcttcaagcgattgctgggacgatcccttccgccgccggcggtg
gaggacctgcccagcgcgctgcagaccacgcagcccatgccccggtgggccggctcccgg
ctggacaactatgagctcggccaggaaatcggtcggggcgccatggccaaggtccaccag
gcggtggaccggcgcagcggcggttcggtcgccatcaagcggctgtccctgcagcgcgag
ttcgcgccggaagacctggtggatgtgcgcgagcgcttcatccgcgaagccagcgcggct
ctgcatctgacgcatccggacatcctacgggtgctcgatgctggcgaaagtggcggcgac
acctggatcgcgatggaactggtggtcgggcacgacctgagccactacacccgcgaaagc
cagcgcctgcccctgcgcgaggtgctgctgctgggcgcccggctcgcgcgggcgcttcac
tacgcccacagccacggggtggtgcaccgggacatcaaaccggccaacgtcatgctcgac
cggcccaccggcagcgtgaagatcatggatttcggcatcgcccgcgtggcggacggcagc
cgcacccggaccgggctggtcctgggcaccccctcctacatgtccccggaacagttggcc
ggattgaaggtggatggccgcagcgacctgtattctttaggcgtcatgttgtttcagctt
ttgacagggcatctgccccatcaatcggagtccatggcgtccctgatgcatcaaatcgcc
aaccagcccccgcccgacgtccgtctgtaccgccaggaactgccggagtcgctggccatg
gtggtggcgttgtcgcttgaaaagcggcctgaacttcgctatcagtccggtgagcaactg
gcgcaggacctggaagcggtcctggccgaccttccggtcggtctggccaacagccggggc
gacgtttcagcatcccccgcaggtgggagcgcaaagcgcaccgatgagggcgatcccacc
acaacccccccgacagcggggctggctttcgaggaaactttacgcctgcgcagcagcgcg
gcggtgcacaatcatcctcccccagacgatcccgcccgcaagacatga

DBGET integrated database retrieval system