KEGG   Roseateles depolymerans: RD2015_4715Help
Entry
RD2015_4715       CDS       T04166                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
rdp  Roseateles depolymerans
Pathway
rdp00970  Aminoacyl-tRNA biosynthesis
rdp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rdp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RD2015_4715
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rdp03029]
    RD2015_4715
Enzymes [BR:rdp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RD2015_4715
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RD2015_4715
Mitochondrial biogenesis [BR:rdp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RD2015_4715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ALV09154
UniProt: A0A0U3LRT4
LinkDB All DBs
Position
5528767..5530221
Genome map
AA seq 484 aa AA seqDB search
MSKNSKLVRGYEVVIGLENHVQLSTASKIFSGSSTAFGAAPNTQASAVDLALPGTLPVLN
RGAVERAIRFGLAVGAKVAPLSIFARKNYFYPDLPKGYQISQYEIPVVQGGKIEFMVDGE
RKVVNLTRAHLEEDAGKSLHEDYHGQSGIDLNRAGTPLLEIVSEPEIRSAAEAAEYAKTL
HALVMWLGICDGNMQEGSFRCDVNVSVRKPGEPFGTRREIKNLNSFRYLVDAVHYEVNWQ
IDRIEDGLEIQQATVLYNPDTGETRAMRTKEDAADYRYFPDPDLPPLMIAPDWIERVRGD
MPELPAVMAARFQDTDGLPAYDALMMTQSLATARFYEAAREVSGAPKLVANWLMGEVSRR
LNAEERDIESAPVTPTQLGQLIRRIQDGTISNNSAKQVFEALWTGEASDVDAVIDAKDLK
QSNDTGELERILDEVLAANAKSVEEFRAGKEKAFNALVGQAMKATKGKANPAAVNELLKK
KLGA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaacagcaaactggtgcgcgggtacgaggtcgtgatcggcctggaaaaccac
gtgcaactctccacggcctccaagatcttcagcggttcctccaccgccttcggggctgcc
cccaacacgcaggccagcgcggtggacctggccctgcccggcacgctgccggtgctcaac
cgcggcgcggtggagcgggccatccgcttcggtctggccgtcggtgccaaggtggcgccg
ctgtccatcttcgcccgcaagaactacttctatccggacctgcccaagggctaccagatc
agccagtacgagatcccggtcgtgcagggcggcaagatcgagttcatggtggacggcgag
cgcaaggtggtgaacctcacccgcgcccacctggaagaggacgccggcaagagcctgcac
gaggactatcacggccagtccggcatcgacctgaaccgtgccggcacgccgctgctggag
atcgtctccgagccggagatccgctccgccgccgaggccgcggaatatgccaagacgctg
catgcgctggtcatgtggctgggcatctgcgacggcaacatgcaggaaggctccttccgc
tgcgacgtcaacgtgtcggtgcgcaagcccggtgaaccgttcggcacgcgccgcgagatc
aagaacctcaacagcttccgctacctggtggacgcggtgcactatgaggtgaactggcag
atcgaccgcatcgaggacgggctggagatccagcaggccaccgtgctctacaacccggac
accggcgagacccgggccatgcgcaccaaggaagatgcggccgactaccgctacttcccg
gacccggacctgccgccgctaatgattgcgccggactggatcgagcgggtgcggggcgac
atgccggagctgccggcggtcatggccgcgcgcttccaggacaccgatggcctgcccgcc
tacgacgcgctgatgatgacgcagagcctggccacggcccggttctacgaggcggcccga
gaggtcagcggcgcgcccaagctggtggcgaactggctgatgggcgaggtctcgcgccgg
ctcaatgccgaggaacgcgacattgagtccgccccggtcacgccgacgcagctgggccag
ctgatccgccgcatccaggacggcaccatctcgaacaactccgccaagcaggtcttcgag
gccctgtggaccggcgaggcatcggacgtggacgccgtcatcgacgccaaggatttgaag
cagtccaacgacacgggtgagctcgaacgcatcctggacgaggtgctggcggccaatgcc
aagtcggtggaggaattccgcgccggcaaggagaaggcgttcaatgcgctggtcggccag
gccatgaaggcgaccaagggcaaggccaatccggcggcggtgaatgagctgctgaagaag
aagctgggcgcttga

DBGET integrated database retrieval system