KEGG   Roseateles depolymerans: RD2015_615Help
Entry
RD2015_615        CDS       T04166                                 

Definition
(GenBank) malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
rdp  Roseateles depolymerans
Pathway
rdp00620  Pyruvate metabolism
rdp01100  Metabolic pathways
rdp01120  Microbial metabolism in diverse environments
rdp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rdp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RD2015_615
Enzymes [BR:rdp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     RD2015_615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M AlaDh_PNT_C Malate_DH
Motif
Other DBs
NCBI-ProteinID: ALV05112
UniProt: A0A0U3C8M1
LinkDB All DBs
Position
698051..700372
Genome map
AA seq 773 aa AA seqDB search
MSEHNDGHGLSPAEAALREAALDYHRLPTRGKIAVTPTKALSNQRDLSLAYSPGVAYPCL
DIEKDPTLAAEYTSRGNLVGVITNGTAVLGLGDIGPLAAKPVMEGKGCLFKKFAGIDVFD
IELAERDPDKLVEIIAAMEPTLGGINLEDIKAPECFYIEKQLSARMNIPVFHDDQHGTAI
ISSAALLNGLELVGKDIGAVKVAVSGAGAAAIACLDVMVGLGVKRENIFVVDSKGVIQTD
RADASKLDESKRRYCQTTPARTLADVVQGADVFLGCSAAGVLTGEMVATMARQPIILALA
NPEPEIRPELAKQARPDCIMATGRSDYPNQVNNVLCFPYIFRGALDCGATKITEAMKLAC
VREIAALAKAETPPEVAAAYAGQELVFGPDYIIPKPFDARLILRIAPAVAKAAAESGVAT
RPIQDMDAYREQLSRFVYQTGMFMRPVFAAAKASPARVIYAEGEDERVLRAVQVALDEGL
ARPTLIGRPEVIQMRIQRAGLRLKLGEDVAVIDPENDARFRQYWEAYHQIMGREGFTPEM
SKSAVRRSNTTIGALAIHLGDADAMICGLVGRFDSHLEHVNNLIGLKPGVRNFATMNALM
LDQRTLFIADTFVNDDPDADQLAEIAAQAVDELKRFGLPPKLAFLSHSMFGSSKRPSAVK
MREARDLFVEQHPDVECDGEMHGDAALSEDVRHTFLPDSTLKGEANLLVLPTLDAANILF
NVLKIVGGQGVTVGPILLGAARPVHILTPSATVRRIVNMTALAVADVQANRAA
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacacaacgacggccacggcctgagtcctgccgaagcggcgctgcgtgaggct
gcgctggactatcaccgcctgccgacccgcggcaagattgccgtcacgccgaccaaggcc
ctgtccaaccagcgcgacctgtccctggcgtattcgccgggggtggcgtatccgtgcctg
gacatcgagaaggacccgaccctggcggcggagtacacctcgcggggcaacctggtggga
gtgatcaccaatggcacggcggtgctgggcctgggcgacatcggtccgctagctgccaag
ccggtgatggagggcaagggctgcctgttcaagaagtttgccggcattgatgtgtttgac
atcgagctggccgagcgggacccggacaagctggtcgagatcattgcggcgatggagccc
acgctgggcggcatcaatttggaagacatcaaggcgccggagtgcttctacatcgagaag
cagctcagcgcccggatgaacattccggtcttccacgacgaccagcacggcacggccatc
atctccagcgcggcgctgctcaacggcctggagctggtgggcaaggacattggggcggtc
aaggtggcggtgtcgggcgcgggcgctgcggccattgcctgcctggacgtgatggtgggc
ctgggcgtcaagcgcgagaacatcttcgtcgtggactccaagggtgtcatccagaccgac
cgtgccgatgcgtccaagctggacgagtccaaacgccggtactgccagaccacgccggcc
cgcaccctggcggacgtggtgcagggggctgacgtcttcctgggctgctccgctgcgggc
gtgctgaccggtgagatggtggccaccatggcccgccagcccatcatcctggcgctggcc
aatccggagccggagatccgtccggagctggccaagcaggcgcggccggactgcatcatg
gccacgggccgttcggactatccgaaccaggtcaacaacgtgctgtgcttcccctacatc
ttccgcggcgcgctggactgtggcgccaccaagatcaccgaagccatgaagctggcctgc
gtgcgcgagattgccgcgctggccaaggccgagacaccgccggaagtggcggcggcctat
gcaggccaggagctggtcttcggcccggactacatcattcccaagccctttgatgcccgc
ctgatcttgcgtattgcgccggcggtggccaaggcagcggcggagtccggcgtggccacg
cggccgatccaggacatggacgcctaccgcgagcagctctcgcgcttcgtctaccagacc
ggcatgttcatgcgcccggtgtttgctgcggccaaggcctcgccggcccgtgtcatctat
gcggaaggcgaggacgaacgcgtgctgcgcgccgtgcaggtcgcgctggatgaaggcctg
gcccgtcccacgctgatcggacgtccggaagtcatccagatgcgcatccagcgtgcgggc
ctgcgcctgaagctgggcgaggatgtggccgtcatcgaccccgagaacgatgcccgcttc
cgccagtactgggaggcgtatcaccagatcatgggccgcgagggcttcacgccggagatg
tccaagtcggcggtgcgccgctccaacaccaccattggggcgctggccatccacctgggc
gatgcggacgccatgatctgcggcctggtcggccggtttgactctcacctggagcatgtc
aacaacctcattggcctcaagcccggcgtgcgcaacttcgccaccatgaatgcgctcatg
ctggaccagcgcaccctgttcattgccgacaccttcgtcaatgacgacccggatgccgac
cagcttgcagaaattgcggctcaggcggtggacgagctcaagcgctttggcctgccgccc
aagctggccttcctctcgcattcgatgttcggttccagcaagcggccgtcggcggtgaag
atgcgcgaggcgcgtgacctcttcgtcgaacagcatccggacgtggaatgcgacggcgaa
atgcatggtgacgccgctctttccgaggacgtgcgtcacaccttcctgccggacagcacc
ctcaagggcgaggccaacctgctggtgctgccgacgctggatgcggccaacatcctcttc
aacgtgctgaagatcgtcggcggccagggcgtcacggtgggccccatcctgctgggggcg
gcgcgtccggtgcacatcctgacgccgtcggccacggtgcgccgcatcgtcaacatgacg
gcgctggcggtggcggacgtccaggccaaccgggcggcctga

DBGET integrated database retrieval system