KEGG   Rhodococcus erythropolis BG43: XU06_00165Help
Entry
XU06_00165        CDS       T03842                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
reb  Rhodococcus erythropolis BG43
Brite
KEGG Orthology (KO) [BR:reb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:reb01001]
    XU06_00165
Enzymes [BR:reb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     XU06_00165
Protein kinases [BR:reb01001]
 Serine/threonine kinases: Other
  Bacterial family
   XU06_00165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Pkinase_fungal Kinase-like Haspin_kinase RIO1
Motif
Other DBs
NCBI-ProteinID: AKD95395
UniProt: A0A0E4A1H4
LinkDB All DBs
Position
complement(36020..37378)
Genome map
AA seq 452 aa AA seqDB search
MALNNGALIADRYRLIRLIATGGMGQVWEATDSRLNRRVAVKVLKSEFSSDPEFLERFRF
EARTTAQLNHPGIAGIYDYGETRDSSGDSTAYLVMELVNGEPLNAVLARVGRLAVPHALD
MLEQTGRALQVAHDAGVVHRDVKPGNILITPTGQVKITDFGIAKAVENSPVTRTGMVMGT
AQYIAPEQALGQDATAASDVYSLGIVGYEALSGRRPFTGDGALTVAMKHVQETPAPMPAD
LPANIRELIDITLTKDPAGRYASGGEFADAVAAVRAGRRPPPPGLLATGAASALPATGAT
QVMPPTYAGPVTGAAVADDAAAGGMTSGQKAVAWAGGGLILLALIIGGVWIATDGPSDPT
PPVVTSTTLPTTTTTKPTTTTTRPTTTTTEPTTTTTRPTTTTTEPTTTTTTPTTTTTTPT
TTTTTTTTTTTTTTTEPLADPGDAEEPLGQDQ
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
gtggcgttgaacaacggcgctttgatcgccgatcgttaccgattgatccgtctcatcgcc
accggtgggatgggtcaggtgtgggaagccaccgactcccggctcaaccgtcgcgtcgcc
gtcaaggtactcaagtccgagttctcttccgatccggagttcttggagcgcttccgcttc
gaggcccgcaccaccgcgcagctcaaccatcccggtatcgccggaatctacgactacggc
gagacccgtgacagctcgggcgattccacggcgtacctggtgatggaactcgtcaacggt
gagccgctcaacgccgtcctggcacgcgtcggccgcctggcggttccgcatgccctcgac
atgctcgagcagaccggccgcgccctgcaggtcgcacacgacgccggtgtcgtgcaccgc
gacgtgaagccgggcaacatcctcatcacgccgacgggccaggtgaagatcacggacttc
ggcatcgccaaggccgtcgagaactctcctgtcacgcgtacgggaatggtgatgggcacc
gcccagtacatcgcgcccgagcaggctctcggtcaggacgcgaccgcggcgagtgacgtg
tactcgctgggaatcgtcggatacgaagcactttcgggtcgacgcccgttcaccggtgac
ggcgcgctcaccgtcgcgatgaagcacgtgcaggaaaccccggcgccgatgccggccgac
ctgccggcgaacatccgcgagctcatcgacatcacgttgaccaaggatccggccggccgt
tacgccagtggcggtgagttcgccgacgccgttgcagccgttcgagcagggaggcgtcca
ccgccgcccggtctgctcgccaccggtgccgcgagcgcgttgccggctacgggtgccacg
caggtcatgccgccgacgtacgcgggcccggtgacgggcgcagctgttgcggacgacgcg
gcagccggcggaatgaccagtgggcagaaggccgtggcatgggccggcggcggattgatc
ttgttggcgttgatcatcggcggagtctggatcgcgaccgacggtccgagcgacccgacg
ccgcccgtcgtcacgtccacgacgttgccgaccaccacgacgaccaagcccaccaccacg
acgactcggccgacgacgacgaccaccgagccgacaacaacgacgactcggccgacgaca
accacgaccgagccgacaaccaccacgacaactccgaccacgacaacaacaactccgacg
accacaaccaccaccacgacgacaacgacgaccacaacgaccactgagccgttggcggat
cccggagacgctgaagaaccgctaggacaagaccaatga

DBGET integrated database retrieval system