KEGG   Rhodococcus erythropolis BG43: XU06_05240Help
Entry
XU06_05240        CDS       T03842                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
reb  Rhodococcus erythropolis BG43
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AKD96245
UniProt: A0A0E4A3G3
LinkDB All DBs
Position
complement(1151118..1152563)
Genome map
AA seq 481 aa AA seqDB search
MTDYDKLYIGGAWVAPATDQVLEVFSPATEERVGSCPIAAPADIDAAVSAARAAFEGPWS
RTTPAERGAILAKAAKLIEERSAEINQLISNEMGQPPAMVGMMQQTPSMATLGYYAELAD
KFAWEEKRTGAFGQTKVTREPVGVVAAVLAWNVPLFLAINKLAPALLAGCTVLLKPAPES
PLSVHVIAEIFTEAGVPEGVISVLPGGAETGEYLVSHAGIDKITFTGSSAVGRKIGAIAA
QNLKRCSLELGGKSAAIILEDADIAAGMPMLVMSGLMNTGQACVAQTRILAPRSRYDEVI
EGMKTAAGFMTVGDPSDPAAQLGPLISEKQRERVEGYIAKGKEEGARVVLGGGRPAGLDK
GWYVEPTIFADVDNSMTIAREEIFGPVLSVIPYDSEDEAIKIANDSDYGLAGSVWTTDID
HGLEVAAQIRTGTYAINWYAFDPGSPFGGYKNSGIGRENGPEGLEAFCETKSVLMPPGYV
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgactgactacgacaagctctacatcggtggagcatgggtggccccggccaccgaccag
gtactcgaagtgttctctcccgcaacggaggagcgcgtcggcagctgtcccatcgcagca
ccggcagacatcgacgcggccgtgtccgcagcccgcgcggcgttcgagggaccgtggtca
cgcaccacgcccgccgagcgcggcgcgatcctcgccaaggccgccaagctgatcgaagag
cgcagcgcggaaatcaaccagctcatctccaacgagatgggccagccgcccgccatggta
ggcatgatgcagcagaccccgtcgatggcgacgctgggctactacgccgagctggccgac
aagttcgcgtgggaagagaagcgcaccggcgcattcgggcagaccaaggtgacccgtgag
cccgtcggcgtcgtcgctgccgtgctggcctggaacgtcccgctgttcctggcgatcaac
aagctggcccccgcactgctcgccggctgcaccgtactgctcaagcccgcacccgaatcc
cctctctccgtccacgtgatcgccgagatcttcaccgaggcaggcgttcccgaaggcgtc
atctccgtgctccccggcggagccgagaccggcgaatacctggtctctcatgcgggcatc
gacaagatcacgttcaccggatccagcgccgtcggccgcaagatcggtgccatcgccgcg
cagaacctcaagcgctgctccctcgaactgggtggcaagtccgccgcgatcatcctcgag
gacgccgacatcgccgccggaatgccgatgctcgtcatgtccggcctgatgaacaccggc
caggcctgtgtcgctcagacccgaatcctcgctccccgttcgcgttacgacgaggtcatc
gagggaatgaagaccgcggcaggcttcatgaccgtcggcgatccgtccgatcccgcagca
caactcggcccgctgatctccgagaagcagcgcgagcgcgtcgagggctacatcgccaag
ggcaaggaagaaggcgcgcgcgtcgtactcggtggtggacgtcccgccggcctggacaag
ggctggtacgtcgagccgacgatcttcgccgacgtggacaactcgatgaccatcgcacgc
gaggagatcttcggacccgttctctcggtgatcccgtacgactccgaggacgaggccatc
aagatcgccaacgattcggattacggactcgccggatcggtgtggaccaccgacatcgat
cacggactcgaagttgccgcgcagatccgcactggtacctacgcgatcaactggtacgcc
ttcgatcccggatcaccgttcggtggttacaagaactccggtatcgggcgcgagaacgga
cctgagggcctcgaagccttctgcgagaccaagtccgtactcatgccgcccggctacgtg
ggctga

DBGET integrated database retrieval system