KEGG   Rhodococcus erythropolis BG43: XU06_09865Help
Entry
XU06_09865        CDS       T03842                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
reb  Rhodococcus erythropolis BG43
Pathway
reb00020  Citrate cycle (TCA cycle)
reb00480  Glutathione metabolism
reb01100  Metabolic pathways
reb01110  Biosynthesis of secondary metabolites
reb01120  Microbial metabolism in diverse environments
reb01130  Biosynthesis of antibiotics
reb01200  Carbon metabolism
reb01210  2-Oxocarboxylic acid metabolism
reb01230  Biosynthesis of amino acids
Module
reb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:reb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XU06_09865
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    XU06_09865
Enzymes [BR:reb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     XU06_09865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AKD97023
UniProt: A0A0C3ABP0
LinkDB All DBs
Position
2150500..2151723
Genome map
AA seq 407 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLEYYDLGIEYRDETDDQVTIDA
AHAIQKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFRAPIIISNVPRL
VPGWTKPIIIGRHAFGDQYRATDFKVPGPGKVMITYTPEDGSAPIEHELVNFPEEGGVVQ
GQYNFTTSIRDFARASLTYGLQQNYPVYLSTKNTILKAYDGAFKDIFQHVYETEFKAEFD
AAGLTYEHRLIDDMVASALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLTPDG
RTCEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLEHRGKLDSTPEVIGFAQALE
DVVIKTVESGQMTKDLSMLVGGDQGYLTTEEFLGALDVNLQKAMAAK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaatcaaggttgagggcaccgtcgtcgaactcgacggcgatgagatgacgcgc
attatctggcagttcatcaaagacaagttgatccatccgtatctcgatgtgaacctcgag
tactacgacctcggtatcgagtaccgcgacgagaccgacgaccaggtcaccatcgacgca
gcgcacgcgatccagaagcacggcgtcggcgtcaaatgcgccacgatcacgccggacgag
gcacgtgtcgaggaattcggtctcaagaagatgtggcgttccccgaacggaacgatccgc
aacattctcggcggcacgatcttccgcgcaccgatcatcatctccaacgttccgcgactc
gttccgggctggaccaagccgatcatcatcggccgtcacgcattcggcgaccagtaccgc
gccacagacttcaaggtccccggccccggcaaggtgatgatcacctacacgcctgaggac
ggcagcgcaccgatcgagcacgaactggtcaacttccccgaagagggcggcgtcgtccag
gggcagtacaacttcaccacgtccatccgtgacttcgctcgcgcgtcgctcacctacgga
ctgcagcagaactacccggtgtacctgtccaccaagaacaccattctcaaggcgtacgac
ggtgccttcaaggacatcttccagcacgtctacgagaccgagttcaaggctgagttcgat
gccgcaggtttgacctacgagcaccgcctcatcgacgacatggtcgcttccgcactcaag
tgggagggtggatacgtctgggcatgcaagaactacgacggcgacgtccagtccgacacc
gtggcccagggcttcggctcgctcggcctcatgacgtcggttctgctgacaccggacgga
aggacctgtgaggcagaggctgctcacggcaccgtgacgcgtcactaccgtcagcaccag
cagggcaagcccacctcgaccaacccgatcgcgtccatcttcgcgtggacccgcggactc
gagcatcgtggcaagctcgacagcacccctgaggtcatcggcttcgcgcaggcgctcgaa
gacgttgtcatcaagaccgtcgaaagcggccagatgaccaaggacctctcgatgctggtc
ggcggcgatcagggctacctgaccaccgaggagttcctcggcgcactcgacgtgaacctg
cagaaggccatggccgcgaagtag

DBGET integrated database retrieval system