KEGG   Rhodococcus erythropolis BG43: XU06_24025Help
Entry
XU06_24025        CDS       T03842                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
reb  Rhodococcus erythropolis BG43
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AKD99396
UniProt: A0A0E4AB25
LinkDB All DBs
Position
complement(5227713..5228759)
Genome map
AA seq 348 aa AA seqDB search
MELPLMPPLAPMLAKAAATVPPQPESGDPTWSYEPKWDGFRAIIFRDGDEVVLGSRGGKD
LARYFPEAVEAVKSELPEKCVVDGELVVPREIDGVTRLSWEALSERIHPAASRVALLSEQ
TPAQFVGFDLLALGDRDVSIEDFGVRRALLLDCVGGGPSCHVTAATADSAEAMAWFETFE
GAGLDGVVAKKLAGPYLPNKREMIKVKHARTADVVLLGYRPHKSQPGIGSMLLGLFDGSE
LKMIGGASAFTAARRIELLAELEPLRLGDDVVAEGEASRWRSAADRSWIPLRPERVLEVA
YDQMEGERFRHAARFLRWRPDRVPDECTFDQLEVPVRYDFADVLAGGK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtggagctacccctgatgccgccgcttgccccgatgctcgcgaaggctgcggccactgtg
ccgcctcagcccgagtccggtgacccgacgtggtcgtacgagccgaaatgggacggattt
cgagcaatcatctttcgtgacggtgacgaagtggtgctcggatcgcgaggaggaaaggac
ttggcgcggtactttcccgaggcggtggaagccgtcaagtctgaattgcccgaaaaatgt
gtggtggacggagaactggtggttccccgtgagatcgacggtgtgacgcgcctgagttgg
gaagcgctctccgagcggattcaccccgccgcgagccgcgtcgcattgttgtcggaacag
acgcccgcgcaatttgtcgggttcgatttactggcgctcggggatcgcgacgtctcgatc
gaggacttcggtgtgcgacgtgcgttgctcctcgattgcgtcggtggcgggccgagttgc
cacgtcacggcagcgacggccgacagcgccgaagcaatggcctggttcgaaaccttcgaa
ggcgcgggcctcgacggggttgtcgccaagaagctggcgggaccgtacctgccgaacaaa
cgcgagatgatcaaggtgaaacacgccaggaccgcggatgtcgtactgctgggctaccgt
ccgcacaagagccagccgggtatcgggtcgatgcttctgggtctgttcgacggttccgaa
ttgaagatgatcggtggcgcttcggctttcaccgcggcgcggcggatcgagttgttggcc
gaactcgaacctttgcgcctcggggacgacgttgtggccgagggagaggccagccggtgg
agatcggccgcagaccgctcctggattccgcttcgtcctgagcgggtgctggaagtggcg
tacgaccagatggaaggggaacgctttcggcacgccgcgcggttcctgcgctggcgtccg
gacagggtgcccgacgaatgcactttcgatcagttggaggttccggtgcgatacgacttc
gcggatgttcttgcaggtggtaagtga

DBGET integrated database retrieval system