KEGG   Rhodococcus erythropolis BG43: XU06_26640Help
Entry
XU06_26640        CDS       T03842                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
reb  Rhodococcus erythropolis BG43
Pathway
reb00020  Citrate cycle (TCA cycle)
reb00190  Oxidative phosphorylation
reb00650  Butanoate metabolism
reb01100  Metabolic pathways
reb01110  Biosynthesis of secondary metabolites
reb01120  Microbial metabolism in diverse environments
reb01130  Biosynthesis of antibiotics
reb01200  Carbon metabolism
Module
reb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:reb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XU06_26640 (sdhA)
   00650 Butanoate metabolism
    XU06_26640 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    XU06_26640 (sdhA)
Enzymes [BR:reb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     XU06_26640 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     XU06_26640 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO NAD_binding_8 HI0933_like GIDA Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AKD99850
UniProt: A0A0E4ACJ3
LinkDB All DBs
Position
5755164..5757116
Genome map
AA seq 650 aa AA seqDB search
MNSFELDDLRSIGTPVDGKVPAGDPETAWPTRKLDYKLVSPLNRRKFTVIVVGTGLAGAA
CAASLGELGYHVESFTFHDAPRRAHSVAAQGGINAARARKVDNDSLARFVKDTVKGGDFR
GREADCFRLAEESVRVIDHMNAIGAPFAREYGGTLATRSFGGVQVSRTYYTRGQTGQQLQ
IASSQALQRQIAAGTVNLHTRTEMLDLIVSDGRAQGIVTRDLVTGEIGATTGHAVVLASG
GYGTVFHKSTLAKNSNATAAWRAHRRGALIASPSFIQFHPTALPVNSEWQSKTILMSESL
RNDGRIWVPAKPGDDREPGDIPENERDYYLERKYPAFGNLSPRDVSSRAAREQIDSGHGV
GPLKNSVYLDFRDALARLGRKTIEERYGNLFSMYRDATSEDPYTVPMRIAPGAHFTMGGL
WNDYDQMTSIPGLFVGGEAGWGYHGANRLGANSLLSACVDGWFTLPYAIPNYLAPLLGSA
PLELSDPAVTSTLSDVSGRVDLLLSVGGTHGPDRFHRQLGEILYAGCGVTRTAEGLTKAI
SEIRALRGDFWSNLRVAGSGNQFNQELERAGRVADFLELAELMCVDALDRDESCGAHFRA
EHQTPDGEAQRNDKDWCFVSAWETAKDGRHIRHDEPLSFTAVPLQTRNYV
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
gtgaacagcttcgaactcgacgatctgcgcagcatcgggacgccggtggacggtaaggtc
ccggccggcgatccggagacagcctggcccactcgcaaactcgactacaagctcgtcagc
ccgctcaaccggcgcaagttcacggtcatcgtcgtcggtaccggactcgccggcgcggcc
tgcgccgcctcacttggtgaactgggctaccacgtcgaatccttcaccttccacgatgca
ccgcgccgtgcacacagcgtcgccgcgcagggcggcatcaacgccgctcgtgcccgaaag
gtggacaacgacagtctcgcccgcttcgtgaaggacaccgtcaagggcggcgatttccgc
ggccgcgaggccgactgcttccgactcgcagaggaatccgtacgcgtcatcgatcacatg
aatgccatcggagcaccgttcgcccgtgagtacggcggcactctcgccacccgatccttc
ggcggcgtacaggtgtcgcgcacgtactacacgcgcgggcagacaggccagcagctgcag
atagcgtcgtcgcaggcactgcaacgtcagatcgcagccggaacggtcaacctccacacc
cgaaccgagatgctcgatctcatcgtttcggacggtcgagcacaagggatcgtcacacgc
gatctcgtgaccggtgagatcggcgccaccacaggccatgccgtcgtgctggcctccggt
gggtacggcaccgtgttccacaagtccacacttgcgaagaactccaacgccaccgccgca
tggcgagcgcaccgacgcggcgcgctgattgcctcaccctcgttcatccaattccatccg
acggcacttcccgtcaactccgagtggcagtcgaaaaccattctgatgagcgaatcacta
cgcaacgacggccggatctgggtaccggccaagcccggagacgatcgcgaaccaggcgac
attcccgaaaatgagcgcgactactacctcgagcgcaaatatccggcgttcgggaacctc
tctccccgcgacgtctcttcacgggccgcccgcgagcaaatcgactccggtcacggcgtc
ggccctctgaaaaacagtgtgtaccttgatttccgcgatgcattggcacggctcggccgc
aagaccattgaggagcgatacggaaatctgttctcgatgtatcgcgacgccaccagcgaa
gacccctatacggtgccgatgcgcatcgcccccggagcccacttcaccatgggaggactg
tggaacgactacgaccagatgacctccatccccggcttgttcgtcggtggtgaggcaggg
tggggataccacggggccaaccgcctcggcgccaattcgctgctttcggcctgcgtcgac
ggctggttcaccctcccgtacgcgattccgaattatcttgcgccgctactcggatcagca
cctctcgaactttccgatcccgccgtgacgtcgacgctcagtgacgtgagcggtcgggtg
gacctgctgctctcggtcggcggaacacacggccccgacaggtttcatcgacaactgggc
gagatcctctatgcgggttgcggtgtcacccgaacggccgaaggcttgaccaaggccatc
tccgaaatccgagcattacgaggcgatttctggtcgaacctacgagtcgccggcagcgga
aaccagttcaaccaggagctggaaagggccggcagggtagccgatttcctcgaactcgcc
gaactgatgtgcgtcgacgctctcgatcgtgacgagtcctgtggagcccactttcgtgcc
gaacatcagactcccgacggcgaagcacagcgaaacgataaggactggtgcttcgtctcc
gcgtgggaaaccgccaaggacggcagacacattcgacacgacgagccgttatccttcacc
gctgttccactgcagacgaggaactacgtatga

DBGET integrated database retrieval system