KEGG   Rhodococcus erythropolis BG43: XU06_26645Help
Entry
XU06_26645        CDS       T03842                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
reb  Rhodococcus erythropolis BG43
Pathway
reb00020  Citrate cycle (TCA cycle)
reb00190  Oxidative phosphorylation
reb00650  Butanoate metabolism
reb01100  Metabolic pathways
reb01110  Biosynthesis of secondary metabolites
reb01120  Microbial metabolism in diverse environments
reb01130  Biosynthesis of antibiotics
reb01200  Carbon metabolism
Module
reb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:reb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XU06_26645
   00650 Butanoate metabolism
    XU06_26645
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    XU06_26645
Enzymes [BR:reb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     XU06_26645
    1.3.5.4  fumarate reductase (quinol)
     XU06_26645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_8 Fer4_10 Fer4_9 Fer4_17 Fer4 Fer4_16 Fer4_2 Fer4_4 Fer2 Fer4_21 Fer4_6 Fer4_3 Fer4_18 Fer4_13 Fer4_22 Fer4_15
Motif
Other DBs
NCBI-ProteinID: AKD99851
UniProt: A0A0E4ABZ1
LinkDB All DBs
Position
5757113..5757862
Genome map
AA seq 249 aa AA seqDB search
MKITVDVWRQSGPDSSGAFDTYQVNDATVEMSLLELLDRLNDQLVESGNEPIAFDSDCRE
GICGSCGITVDDVPHGPVANTPTCRQHLRSFSDGDRIKLEPFRSAAFPVVRDLVVDRSAL
DRVLEAGGYVSVNAGTAPDADSQPLSHQSAEAALDFAACIGCGACVAACPNGAAHLFTGS
KLTHLSLVTQGRNERGKRARAMSHQMEADFGPCSTYGECAEVCPADIPLTAIAAVNKESM
RFGLRRKDN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaccgtggacgtgtggcgccaatccggaccggactcgtccggtgcattcgac
acctaccaagtaaacgacgcgacagtggagatgtcactgctggaacttctcgaccgactc
aacgaccaactcgtggagagcggcaacgaacccatcgccttcgattccgactgccgagaa
gggatctgtgggtcctgtggcatcacggtcgacgacgttccccatgggcctgtcgcgaac
actcccacgtgccgtcagcacctgcgcagcttctccgacggcgaccgaatcaaactggaa
ccgttccgctccgccgcttttccggtggtccgcgacctcgtggtcgatcgttcggctctc
gaccgggtcctcgaagccggtggctatgtatcggtcaatgcgggaactgcaccggacgcg
gacagtcagccactctcgcatcaaagtgccgaagctgcactggacttcgccgcgtgcatc
ggctgcggcgcttgcgtggcagcctgccccaacggtgccgcgcacctcttcaccgggtcc
aaactgacccacctgtccctcgtcacgcagggccgcaacgaacgtggcaagcgggcccga
gcgatgtcgcaccagatggaggccgatttcgggccgtgctcgacctacggtgaatgtgca
gaggtgtgtcccgcggacataccgctgaccgcgattgccgctgtcaacaaggaatcgatg
cgattcggattgcggcgcaaggacaactga

DBGET integrated database retrieval system