KEGG   Rhodococcus erythropolis BG43: XU06_27950Help
Entry
XU06_27950        CDS       T03842                                 

Definition
(GenBank) hypothetical protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
reb  Rhodococcus erythropolis BG43
Pathway
reb00071  Fatty acid degradation
reb00280  Valine, leucine and isoleucine degradation
reb00281  Geraniol degradation
reb00310  Lysine degradation
reb00360  Phenylalanine metabolism
reb00362  Benzoate degradation
reb00380  Tryptophan metabolism
reb00410  beta-Alanine metabolism
reb00627  Aminobenzoate degradation
reb00640  Propanoate metabolism
reb00650  Butanoate metabolism
reb00903  Limonene and pinene degradation
reb00930  Caprolactam degradation
reb01100  Metabolic pathways
reb01110  Biosynthesis of secondary metabolites
reb01120  Microbial metabolism in diverse environments
reb01130  Biosynthesis of antibiotics
reb01212  Fatty acid metabolism
Module
reb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:reb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    XU06_27950
   00650 Butanoate metabolism
    XU06_27950
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XU06_27950
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XU06_27950
   00310 Lysine degradation
    XU06_27950
   00360 Phenylalanine metabolism
    XU06_27950
   00380 Tryptophan metabolism
    XU06_27950
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XU06_27950
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XU06_27950
   00281 Geraniol degradation
    XU06_27950
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XU06_27950
   00627 Aminobenzoate degradation
    XU06_27950
   00930 Caprolactam degradation
    XU06_27950
Enzymes [BR:reb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     XU06_27950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AKE00074
UniProt: A0A0E4ABM3
LinkDB All DBs
Position
complement(6031335..6032081)
Genome map
AA seq 248 aa AA seqDB search
MSRKLLRRETHDRTAILTLDRPDSRNALNGFLLQELIVAMAAADQDDAVDAIVLTGADPV
FCAGIDLKAIAAQDPYLMRLVGAASHAPWPATTKPVIGAINGSAITGGLEVALHCDFLIA
SERATFADTHARVGVLPCWGMTVLLPAAVGRRTAIRMSMTGEPLDAETAHAAGLVTEVVA
HVDLIPAALSVGAQISRSHTLAARTLLASYRRADRAIRDSGYDVESHTAQNWNTVTHADA
TRPPSTPG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcaagctcttacggcgtgagactcacgaccggacggccatcctcacactcgac
cgaccagattcgcgcaacgccctcaacggtttcttgctccaggaactgatcgtcgcgatg
gcagcggccgatcaggacgatgccgtcgacgcgatcgtgctcaccggagccgacccagtc
ttctgcgccggcatcgacctcaaagccatcgccgcccaagacccttacctcatgaggctc
gtgggagcagcctcgcacgcaccatggcctgcgacaaccaaaccggtcatcggcgccatc
aacggctcggcgatcaccggtgggctcgaggtcgcactgcactgcgactttctgatcgcc
tccgaacgcgccaccttcgccgatacccacgcacgagtgggagtattaccgtgctggggc
atgactgtcctgctaccagccgcagtcgggcgccgcaccgccatcaggatgagcatgacc
ggggaacctctcgatgcggaaaccgctcacgcagcagggctcgtcacagaagttgtcgcg
catgtcgaccttattcccgcggcgctctcggtcggagcccagatctcacgtagccacacc
ctagctgcacggacactgctggcgtcgtaccgacgagccgaccgggccatacgcgactcc
ggctacgacgtcgagagccacacagctcagaactggaacaccgtcactcacgccgacgcg
acacgtccacccagcacgccgggttga

DBGET integrated database retrieval system