KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0000097Help
Entry
RHECIAT_CH0000097 CDS       T00720                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00250  Alanine, aspartate and glutamate metabolism
rec00410  beta-Alanine metabolism
rec00640  Propanoate metabolism
rec00650  Butanoate metabolism
rec01100  Metabolic pathways
rec01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RHECIAT_CH0000097 (gabT)
   00650 Butanoate metabolism
    RHECIAT_CH0000097 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RHECIAT_CH0000097 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RHECIAT_CH0000097 (gabT)
Enzymes [BR:rec01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RHECIAT_CH0000097 (gabT)
Amino acid related enzymes [BR:rec01007]
 Aminotransferase (transaminase)
  Class III
   RHECIAT_CH0000097 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACE89094
UniProt: B3PWM6
LinkDB All DBs
Position
complement(107135..108415)
Genome map
AA seq 426 aa AA seqDB search
MTATSLTDRKNAAISRGVGMTTQIYADRAENAEIWDKEGRRYIDFAAGIAVLNTGHRHPK
VIAAVKDQLDHFTHTCHQVVPYESYVSLAERLNALLPGDFEKKTIFVTTGAEAVENAVKI
ARAATGRSAVIAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPGDVFHVPFPVELHGVTAD
QSLAALKKLFAADVDPQRVAAIIIEPVQGEGGFYPAPAAFMKALRELCDQYGILLIADEV
QTGFARTGRMFAMDHHEVAADLTTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGN
PLGIAAAHAVLDVIKDEDLCNRANQLGGRLKQRLESLRETVPEIADIRGPGFMNAVEFND
RTTGLPSAEFANRVRLIALDKGLILLTCGVHGNVIRFLAPITIQDEVLGEALDILEASML
EASAAK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgacaagccttacggaccggaagaacgccgcgatttcgcgcggcgtcggcatg
accacccagatctatgcggaccgggcagagaatgccgagatctgggacaaggaggggcgc
cgctatatcgatttcgccgccggcatcgccgttctcaacaccggccaccgtcaccccaaa
gtcatcgcggcggttaaggatcagctcgaccatttcacccacacctgccaccaggttgtt
ccctacgaaagctatgtcagccttgccgaacggttgaacgccctgctgccgggtgacttc
gagaagaagacgatcttcgtcacgacgggcgctgaggcggtggaaaatgccgtcaagatc
gcgcgtgcggcaaccggccgctcggccgtcatcgccttcggtggcggctttcacggccgc
accttcatgggcatggcgctgaccggcaaggtggtgccctacaaggtcggcttcggcgcc
atgccgggcgacgtgttccatgtccccttcccggtcgagctgcatggcgtcaccgccgat
cagtcgctggcggcgctgaagaagctttttgccgccgatgtcgatccgcagcgggtcgcc
gccatcatcatcgagccggtgcagggcgaaggcggcttctacccggcgccggccgccttc
atgaaggcgctgcgcgagctctgcgaccaatatgggatcctgctgatcgctgacgaggtg
cagaccggttttgcccgcaccggccggatgttcgcgatggatcatcacgaggtggcggcc
gacctgacgacgatggcaaagagccttgctggcggctttccgctcgccgcggtcaccggc
cgcgccgagatcatggacgcgcccggaccgggcggtctcggcggcacatatggcggcaat
ccgctcggcatcgccgctgcgcatgccgtcctcgacgtcatcaaggacgaagatctctgc
aatcgcgccaaccagctcggcggccggctgaaacagcggctggaatcgctgcgcgagaca
gtacccgagatcgccgatatccgcgggccgggcttcatgaatgcggtcgaattcaacgac
cggacgaccggcttgccgagtgccgaattcgccaaccgggtgcggctgatcgcgctcgac
aagggcctgatcctgctgacctgcggcgtccacggcaatgtcatccgcttcctcgcgccg
atcaccatccaggacgaggttctcggcgaggcgctcgacattctcgaggcttcgatgctg
gaagcgagcgcggccaagtaa

DBGET integrated database retrieval system