KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0000680Help
Entry
RHECIAT_CH0000680 CDS       T00720                                 

Gene name
appD
Definition
(GenBank) oligopeptide ABC transporter, ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rec00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RHECIAT_CH0000680 (appD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rec02000]
    RHECIAT_CH0000680 (appD)
Transporters [BR:rec02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    RHECIAT_CH0000680 (appD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_16 AAA_22 CbiA AAA_29
Motif
Other DBs
NCBI-ProteinID: ACE89669
UniProt: B3PPG2
LinkDB All DBs
Position
complement(672772..673797)
Genome map
AA seq 341 aa AA seqDB search
MDTMLQTADTILDIKGLRTVFRIRSGAVTAVDDIDLDVAAGETLALVGESGSGKSVTSLS
VMRLLTRNIGAIAAGRIDLKRKNGTVSNLVDLAEKDMRAVRGNDIGMVFQEPMSSLNPVY
TIGDQISEPLRIHRGANRKAAMDAAVSLLDSVGIPDARRRAGQYPHELSGGMRQRATIAM
ALACDPTLLIADEPTTALDVTIQAQILALLQALQRERGMAMLFVTHNLGVVAEIAHRVAV
MYAGRIVETGPVAEVFRNPRHPYTIGLLASMPKLGDASRMKQAGERLAAIPGVVPSLMNM
PAGCAFQPRCRFAVDACRAAVPPLADVNPRHKSRCIRWQEI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggacaccatgctacagaccgccgacaccattctcgacatcaaggggctgcggaccgtc
ttccgcatccgctcgggcgcggtgacggcggtcgacgacatcgatctcgacgtggcggcg
ggcgagacgctggcgctcgtcggcgagtccggctccggcaaatcggtcaccagcctttcg
gtcatgcggctcctgacccgcaatatcggtgcaatcgccgccggccgcatcgatctgaag
cgcaagaatggcaccgtcagcaatctcgtcgacctcgccgaaaaagacatgcgcgctgtt
cgcggcaatgatatcggcatggtcttccaggaaccgatgtcgagcctcaacccggtctac
acaatcggcgatcagatctcggagccgctccgcattcatcgcggggcgaaccggaaagcc
gccatggatgcggccgtctcgcttctcgacagtgtcggcattcccgatgccaggcgccgt
gccggtcaatatccgcacgaattatccggcggcatgcgccagcgcgccacgatcgccatg
gcgcttgcctgcgaccccacgctcttgatcgccgacgagccaacaacggcgcttgacgtc
accatccaggcgcagatccttgccctcttgcaggcgctgcagcgcgagcgcggcatggcc
atgctcttcgtcacccataatctcggtgtcgtcgccgaaatcgcgcatcgggtggcggtc
atgtatgccgggcggatcgtcgagaccgggccggtggctgaggttttccgcaatccgcgg
catccctatacgatcggcctcctggcctcgatgccgaaactcggtgacgccagccggatg
aaacaggcgggggaaaggctggcggccattccgggcgtcgtgccgagcctgatgaacatg
ccggccggctgcgctttccagccgcgctgccgatttgccgtcgacgcctgccgcgcggcc
gtgccgccgctcgcagatgtcaatccgcgccacaagagccgctgtatccgctggcaggag
atctaa

DBGET integrated database retrieval system