KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0001295Help
Entry
RHECIAT_CH0001295 CDS       T00720                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rec  Rhizobium etli CIAT 652
Brite
Enzymes [BR:rec01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RHECIAT_CH0001295 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACE90276
UniProt: B3PTL6
LinkDB All DBs
Position
1284146..1284748
Genome map
AA seq 200 aa AA seqDB search
MAFELPELPYDYEALAPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEEVVKKS
FGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFASDLGGYDKFKADFANAGA
TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA
FIDSLINWDYVLERYEEATK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgcctgaacttccctatgattacgaagcccttgcccccttcatgtcg
aaggaaacgctggagtttcaccacgacaagcaccacaaggcctatgtcgacaacggcaac
aagctcgccgccgaagccggcctttcggatctgtcgctcgaagaggtcgtgaagaagtcc
ttcggcaccaatgccggcctcttcaacaacgccgcgcagcactacaaccacatccatttc
tggaagtggatgaaaaagggcggcggcggcaacaagctgccgggcaagctggaagcggct
ttcgcctccgatctcggcggctacgacaagttcaaggccgatttcgccaatgccggcgcc
acccagttcggctccggctgggcctgggtttccgtcaagaacggcaagctcgaaatctcc
aagaccccgaacggcgagaacccgctcgtccacggcgccactccgatcctcggcgtcgac
gtctgggaacactcctattacatcgactatcgcaacgcccgcccgaaatacctcgaagcc
ttcatcgacagcctgatcaactgggactacgtcctggagcgctacgaagaagccacgaag
taa

DBGET integrated database retrieval system