KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0001732Help
Entry
RHECIAT_CH0001732 CDS       T00720                                 

Gene name
tufB1
Definition
(GenBank) elongation factor EF-Tu protein
  KO
K02358  elongation factor Tu
Organism
rec  Rhizobium etli CIAT 652
Brite
KEGG Orthology (KO) [BR:rec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rec03012]
    RHECIAT_CH0001732 (tufB1)
   03029 Mitochondrial biogenesis [BR:rec03029]
    RHECIAT_CH0001732 (tufB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rec04147]
    RHECIAT_CH0001732 (tufB1)
Translation factors [BR:rec03012]
 Eukaryotic Type
  Elongation factors
   RHECIAT_CH0001732 (tufB1)
 Prokaryotic Type
   RHECIAT_CH0001732 (tufB1)
Mitochondrial biogenesis [BR:rec03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RHECIAT_CH0001732 (tufB1)
Exosome [BR:rec04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RHECIAT_CH0001732 (tufB1)
  Exosomal proteins of breast cancer cells
   RHECIAT_CH0001732 (tufB1)
  Exosomal proteins of colorectal cancer cells
   RHECIAT_CH0001732 (tufB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: ACE90703
UniProt: B3PW51
LinkDB All DBs
Position
1729245..1730420
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYDFPGDDIPVVKGSALAALEDSDKK
IGEDAIRELMAAVDSYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALVRGVNRDGVERGQILCKPGSVKPHK
KFMAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVAVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagtaagtttgagcgcaacaagccgcacgtcaacattggcacgatcggccac
gttgaccacggcaagacgtctctgacggcagcgatcacgaagtacttcggtgagttcaag
gcgtacgaccagatcgacgcggctccggaagagaaggcccgcggcatcacgatctcgacg
gcgcacgtcgaatacgagacgccgaaccgccactacgcgcacgtcgactgccccggccat
gccgactacgtcaagaacatgatcaccggtgctgcccagatggacggcgcgatcctggtg
tgctcggctgctgacggcccgatgccgcagacgcgcgaacacatcctgctcgcccgccag
gtcggcgttccggcgattgtcgtgttcctcaacaaggtcgaccaggttgacgacgccgaa
ctgctcgagctggttgagctcgaagttcgcgaactgctgtcgtcctacgacttcccgggc
gacgacattcctgttgtcaagggttcggcgcttgccgctcttgaagattctgacaagaag
atcggcgaagacgcgatccgcgagctgatggccgcggtcgactcctacatcccgacgcct
gagcgtccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctccggc
cgcggcacggttgtgaccggccgcgtcgagcgtggcattgtcaaggttggcgaagaagtc
gagatcgtcggcatccgcccgacctcgaagacgacggtgaccggcgttgaaatgttccgc
aagctgctcgaccagggccaggccggcgacaacatcggtgcactggttcgcggtgtgaac
cgtgacggcgtcgagcgtggccagatcctgtgcaagccgggttcggtcaagccgcacaag
aagttcatggcagaagcctacatcctgacgaaggaagagggcggccgtcatacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgacggacgtgaccggcatcgtcacg
ctgccggaaggcacggaaatggtcatgccgggcgacaacgtcacggttgccgtcgagctg
atcgttccgatcgcgatggaagaaaagctgcgcttcgcgatccgcgaaggcggccgcacc
gtcggcgccggtatcgtcgcatcgatcgtcgagtaa

DBGET integrated database retrieval system