KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0002032Help
Entry
RHECIAT_CH0002032 CDS       T00720                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide S-acetyltransferase protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00010  Glycolysis / Gluconeogenesis
rec00020  Citrate cycle (TCA cycle)
rec00620  Pyruvate metabolism
rec01100  Metabolic pathways
rec01110  Biosynthesis of secondary metabolites
rec01120  Microbial metabolism in diverse environments
rec01130  Biosynthesis of antibiotics
rec01200  Carbon metabolism
Module
rec_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHECIAT_CH0002032 (pdhC)
   00020 Citrate cycle (TCA cycle)
    RHECIAT_CH0002032 (pdhC)
   00620 Pyruvate metabolism
    RHECIAT_CH0002032 (pdhC)
Enzymes [BR:rec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RHECIAT_CH0002032 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ACE90993
UniProt: B3PYR4
LinkDB All DBs
Position
2010391..2011743
Genome map
AA seq 450 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDTVKSGDVIAEIETDKATMEVEAVDEGTVAKLV
VAAGTEGVKVNALIAVLAADGEDVAAAAGGAGSPAPAKAEAAPAPKAEAAPAKAEAAPAA
APAAASAAVSAGGNRTFSSPLARRLAREAGIDLSAVAGSGPHGRVVKSDVEAAVAGGGAK
AAAAPAAAAPQAAAAPAPAAAAPKGASEDAVLKLFEPGSYELVPHDGMRKTIARRLVESK
QTIPHFYVSVDCELDALMALRAQLNDAAPRKDGAPAYKLSVNDMVIKAMALALRDVPDAN
VSWTETNMVKHKHADVGVAVSIPGGLITPIIRKAEQKTLSVISNEMRDLGKRAKDRKLKP
EEYQGGTSSVSNMGMMGVKNFAAVVNPPHATILAVGAGEQRVVVKNGEMAIATVMSVTLS
TDHRCVDGALGAELLQAFKGYIENPMGMLV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaatatcacgatgcccgccctctctccgaccatggaagaaggcaatctggcc
aagtggctggtcaaggaaggcgatacggtcaagtcaggcgatgtgatcgccgagatcgag
actgacaaagcgacgatggaagtcgaagctgtcgatgaaggcaccgtcgccaagctcgtc
gttgccgccggcaccgaaggtgtcaaggtcaacgcgctgatcgccgttctcgccgccgat
ggcgaggatgtcgcagccgccgcaggcggtgcgggttcgcccgctccggcaaaggctgaa
gccgcaccggcgccgaaggccgaggctgcgccggcgaaggctgaggcggctccggctgct
gcgcccgctgccgcatccgcggcagtttctgcaggcggcaaccgcaccttctcttcgccg
cttgcccgcaggctcgcgcgggaagccggcatcgacctttcggcggttgcaggctccggc
ccgcatggtcgcgtcgtcaagagcgatgtcgaagccgccgttgccggcggcggtgcaaaa
gctgccgccgcgccggccgctgctgctccgcaggctgccgcagctccggctccggccgcc
gcagcgccgaagggcgcttccgaggacgccgtactcaagctcttcgagccgggctcctac
gagctcgtgccgcatgacggcatgcgcaagacgatcgcccggcgcctggtcgaatccaag
cagacgatcccgcatttctacgtcagcgtcgattgcgagctcgatgcgctgatggcgctg
cgcgcccagctgaacgatgcggctccccgcaaggacggcgctccggcctacaagctttcg
gtcaacgacatggtcatcaaggccatggcgctggcgctgcgggacgttcccgatgccaac
gtctcctggaccgagaccaacatggtcaagcacaagcacgccgatgtcggcgtcgccgtc
tcgatccccggcggcctgatcaccccgatcatccgcaaggccgagcagaagacgctgtct
gtcatctccaacgagatgcgcgacctcggcaagcgggccaaggaccgcaagctgaagccc
gaagaatatcagggcggcaccagttcggtctccaacatgggcatgatgggcgtcaagaac
tttgccgccgtcgtcaacccgccgcatgcgacgatcctcgcggtcggcgccggcgagcag
cgggtcgtcgtcaagaacggcgaaatggcgatcgctacggtcatgagcgtcacgctgtcg
accgaccatcgctgcgtcgacggcgcgctcggcgccgagctgctccaggccttcaagggc
tacatcgaaaacccgatgggcatgcttgtctaa

DBGET integrated database retrieval system