KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0002264Help
Entry
RHECIAT_CH0002264 CDS       T00720                                 

Gene name
moeA
Definition
(GenBank) molybdopterin biosynthesis protein
  KO
K03750  molybdopterin molybdotransferase [EC:2.10.1.1]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00790  Folate biosynthesis
rec01100  Metabolic pathways
Module
rec_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:rec00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RHECIAT_CH0002264 (moeA)
Enzymes [BR:rec01000]
 2. Transferases
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     RHECIAT_CH0002264 (moeA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoeA_N MoCF_biosynth MoeA_C Fe-ADH
Motif
Other DBs
NCBI-ProteinID: ACE91219
UniProt: B3Q0L5
LinkDB All DBs
Position
2265788..2267011
Genome map
AA seq 407 aa AA seqDB search
MNLLPVTEAQNRLLSPAKPVAASETLPLAEAEGRVLAVDLTAGLTQPPFNASAMDGYALR
RDDAPEPGAVLKVIGTSAAGHGFQRSVGHGEAVRIFTGAPVPAGADSVLLQEDAEKVEGG
IRTNFPVRQGQHVRPRGQDFVEGEAVLSAGTVLDFSRLTVAAGMNRPDVEVLKRPLIAIL
ATGDELLPPGSTPGPSQIIASNTFGIAALARKAGADVLDLGIVPDDKGRITAAIELARAA
KADVIVTLGGASVGDHDLVQATLIEAGMQLDFWRIAMRPGKPLMVGSFGETHVLGLPGNP
VSSLVCSLLFLEPLIRKLAALPPVRREATVEAAVSLRANDHRQDYIRAKLSKSAAGNWLA
EPFGKQDSSMMKVFAQADCLIIRPPHAPELPAGAPCPVMLLRPDLLV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcctcccggtcaccgaggcacagaaccgcttgctctccccggcaaagccggtc
gcagcatccgagacgctgccgctcgccgaagcagagggccgcgtccttgccgtcgatctc
acggcgggcctgacacagccacccttcaatgcatcggcgatggatggctatgcgctgcgc
cgagacgacgcgccggagccgggtgctgtgctgaaggtcatcggcacctcggccgctggc
cacggcttccagagaagcgtcggccacggagaggccgtccgcatcttcaccggcgccccc
gtccccgcaggcgccgatagcgttctgttgcaagaggatgcggaaaaggtggaaggcggt
atccgaaccaatttccccgtccgccagggccagcatgtgcgtccccgcggccaggatttc
gtcgaaggtgaagctgtgctgtccgccggcaccgtgctcgatttctcgcggctgacggtc
gcagccggcatgaaccggcccgatgtcgaggttctcaaacgcccgctgatcgccatcctc
gcgaccggcgacgaactgctgccgcccggaagcacgcccggcccttcacagatcatcgca
tccaatacgttcggcatcgcagccctcgcccgcaaggccggcgccgacgtgctcgatctc
ggcatcgtcccggacgacaagggaaggatcaccgcggcgatcgagctggcacgcgctgcc
aaagccgatgtcatcgtcacgctcggcggcgcttcggtcggcgaccatgacctggtccag
gcgacgctgatcgaggccggcatgcagctcgatttctggcgcatcgccatgcgtcccggc
aagccgctgatggtcgggagcttcggcgagacgcatgtgctcggcctgccgggcaatccg
gtttcaagcctcgtctgctcgctgctcttcctggaaccgctgatccgcaagctcgccgcc
ctgccgccggtccggcgcgaggcaacggtggaggcggccgtctcgctgcgcgccaatgac
catcggcaggattatatcagggcaaaactttcgaaatccgccgccggaaactggctggcc
gaacctttcggcaagcaggactcctcgatgatgaaagtgtttgcgcaagccgattgcctc
atcatccgcccgccgcacgcgccggaactgccagccggagcgccctgcccggtcatgctg
ttgcggccggatcttctggtatag

DBGET integrated database retrieval system