KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0002290Help
Entry
RHECIAT_CH0002290 CDS       T00720                                 

Gene name
hisI
Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase protein
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00340  Histidine metabolism
rec01100  Metabolic pathways
rec01110  Biosynthesis of secondary metabolites
rec01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rec00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    RHECIAT_CH0002290 (hisI)
Enzymes [BR:rec01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     RHECIAT_CH0002290 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-ProteinID: ACE91245
UniProt: B3PNV9
LinkDB All DBs
Position
2293553..2294005
Genome map
AA seq 150 aa AA seqDB search
MSHLIFNQPSEDKSALEDAGDFTPRFDDRGLITAIVTDAGDGELLMVAHMNAQALALTIQ
TGTAHYFSRSRGKIWKKGETSGNLQTVKEIRTDCDQDAIWLKVEVAGHDATCHTGRRSCF
YRTVTLREGKPMLDIIDDERHFDPQDIYGK
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacctgatcttcaatcaaccatccgaggacaagtcggcgttggaagacgccggc
gatttcacgccgcgtttcgatgatcgcggcctgatcaccgcgatcgtgaccgacgccggc
gacggtgaactgctgatggtggcgcatatgaacgcccaggcgctggcgctgaccatccag
accggcacggcccactatttcagccgttcgcgcggcaagatctggaagaagggcgagacc
tcgggcaaccttcagacggtgaaggaaattcgcaccgattgcgatcaggacgccatctgg
ctgaaggtcgaagtcgccggccatgacgccacctgtcacaccggccgccgttcctgcttc
tatcgcaccgtcacgcttcgcgagggaaaaccgatgctcgatatcatcgacgacgaacgt
catttcgatccgcaggacatctacggaaaatag

DBGET integrated database retrieval system