KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0002370Help
Entry
RHECIAT_CH0002370 CDS       T00720                                 

Definition
(GenBank) putative maltose alpha-D-glucosyltransferase protein
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00500  Starch and sucrose metabolism
rec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RHECIAT_CH0002370
Enzymes [BR:rec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     RHECIAT_CH0002370
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     RHECIAT_CH0002370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ACE91324
UniProt: B3PP38
LinkDB All DBs
Position
2371619..2373280
Genome map
AA seq 553 aa AA seqDB search
MINDLWYKNAVIYCLSVETFMDANGDGVGDFQGLMRRLDYLSGLGVTAIWLMPFQESPGR
DDGYDVSDYYNVDRRYGTLGDFVEFTHGAKQRGIRVLIDLVINHTSKDHPWFQDARSDPH
SRYREWYVWSEKKPANADHGMVFPGVQKTTWTHDEKAEAYYFHRFYDHQPDLNTSNPEVQ
AEILKIMGFWIQLGVSGFRMDAAPFIIATKGAEVTKPVEQFDMLRKFREFLQWRLGDSIV
LAEANILPKDNFEYFGDDGDRMQMMFNFQVNQALFYAFASADTRPLKKAMEATKPRPATA
QWGLFLRNHDELDLGRLTDKQRGAVFAEFGPDKNMQLYDRGIRRRLAPMLGGDRRRIEMA
YSLLFSLPGTPVIRYGDEIGMGDDLNLPERDCARTPMQWSTEPEGGFTKSPKPITPVIKD
GPYGFEHINVAEQRRDPNSLLNWTERMIRMRKEAPEIGWGDFCVVDTGDDGVLALRYDWR
GNSVLILHNLHAQPAEVTFDPDIGEDGRQLIDIADGASSSADEKGRHTIRLDAYGYRWYR
VGGLDYLLRRKEI
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgacctctggtataagaacgccgtcatctactgcctgtccgtcgagaccttc
atggatgcgaacggcgatggcgtcggtgattttcagggcctgatgcgccgcctcgactat
ctctccggcctcggcgtgacggcgatctggctgatgccgtttcaggagtctcccggccgc
gacgacggctacgacgtctccgattattacaatgtcgaccggcgttatggcacgctcggc
gatttcgtcgaattcacccacggcgccaagcagcgcggcatccgggtgctgatcgatctc
gtgatcaatcacacgtcgaaggatcatccctggtttcaggacgccaggagtgatccgcat
tcgcgctatcgtgaatggtacgtgtggtcggaaaaaaagcctgcgaatgccgatcatggc
atggtcttccccggcgtgcagaagactacctggacccatgacgaaaaagccgaggcctac
tatttccaccgcttctatgatcaccagcccgatctcaacacgtccaatcccgaggtgcag
gccgagatcctcaagatcatgggcttctggatccagctcggcgtctcggggttccggatg
gatgccgcccccttcataatcgcgaccaaaggcgccgaggtcaccaagccggttgagcag
ttcgatatgctgcggaagtttcgcgaattcctgcaatggcgcctcggcgactccatcgtg
ttggcggaggccaatatcctgccgaaggacaatttcgaatatttcggcgacgatggcgac
cgtatgcagatgatgttcaatttccaggtcaaccaagcactgttttatgccttcgccagc
gccgatacccggccgctgaagaaggcgatggaggcaacgaaaccacggccggcaaccgcc
caatggggcctctttctgcgcaaccacgacgagctggatctcgggcggctgacggacaaa
cagcgcggcgctgtctttgccgaattcgggcctgacaagaacatgcagctctatgaccgc
ggcattcgccgccggctggcgccgatgcttggcggcgaccgccgcaggatcgaaatggcc
tacagcctgctgttttcgctgccgggaacgcccgttatccgctacggcgacgagatcggc
atgggcgacgatctgaacctgccggagcgcgattgcgcccgcacgccgatgcagtggtcg
accgagccggaaggcggcttcaccaaaagcccgaaaccgatcacccctgtgatcaaggac
ggtccctacggcttcgagcatatcaatgtcgccgaacagcggcgcgatccgaactcgctg
ttgaactggaccgagcggatgatccgaatgcgcaaggaagctcccgagatcggctggggc
gatttctgcgtggtcgacaccggcgacgacggcgtgctggcgcttcgttacgactggcgc
ggcaattccgtcttgatcctgcacaatctgcatgcgcagccggcggaagtgaccttcgat
cccgatatcggcgaagacgggcgacagctgatcgatattgccgatggcgcaagcagcagc
gccgacgagaaaggccgtcacaccattcggctcgatgcctacggctatcgctggtatcgt
gtcggcggcctcgactatctcctcaggcgcaaggaaatttag

DBGET integrated database retrieval system