KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0002416Help
Entry
RHECIAT_CH0002416 CDS       T00720                                 

Gene name
gstch8
Definition
(GenBank) glutathione S-transferase protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rec00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RHECIAT_CH0002416 (gstch8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rec02000]
    RHECIAT_CH0002416 (gstch8)
Enzymes [BR:rec01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RHECIAT_CH0002416 (gstch8)
Transporters [BR:rec02000]
 Other Transporters
  Pores ion channels [TC:1]
   RHECIAT_CH0002416 (gstch8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_N_4 GST_C_3 Tom37
Motif
Other DBs
NCBI-ProteinID: ACE91370
UniProt: B3PPU1
LinkDB All DBs
Position
2418919..2419545
Genome map
AA seq 208 aa AA seqDB search
MPEELVFYTNPMSRGRIARWMLEEIGQPYRTELMTFGETMKAPEYLSVNPMGKVPAIRHG
TTVVTECAAICAYLAETFPEKGLAPEPEERAAYYRWMFFAAGPLESAVTMKALGFEIPAE
RLRMAGCGSFGDVMNTLEKAVSGSTYLAGERFTAADVYVGSHIGWGLAFGSIEKRQAFVD
YFGRISERPAGKRAKALDDEAGERMQAA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgaagaattggtattctacacaaaccccatgtcacgcggtcgcattgcgcgctgg
atgctggaggaaatcggtcaaccctatcgcaccgaactcatgaccttcggcgaaaccatg
aaggcgcccgaatatctttcggtcaatccgatgggcaaggtgccggcgatccgccacggc
accaccgtggtcaccgaatgcgcggcaatctgcgcctacctcgccgagaccttcccggaa
aaggggctggcccccgaaccggaagagcgcgccgcctattaccgctggatgttctttgcc
gccggcccgctggaatcggcggtgacgatgaaggcactcggtttcgaaattcccgcggag
cgcctgcgcatggccggctgcggcagtttcggcgacgtcatgaacacgcttgaaaaggct
gtgtccggctcgacctacctcgccggcgaacgcttcactgccgccgacgtctatgtcggt
tcccatatcggctgggggctcgcgttcggcagcatcgagaaacgccaggccttcgtcgat
tatttcggccgcatcagcgagcgtccggccggcaagcgcgccaaagccctggacgacgag
gccggcgagaggatgcaggccgcctga

DBGET integrated database retrieval system