KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0002994Help
Entry
RHECIAT_CH0002994 CDS       T00720                                 

Gene name
ddlB
Definition
(GenBank) D-alanine-D-alanine ligase protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00473  D-Alanine metabolism
rec00550  Peptidoglycan biosynthesis
rec01100  Metabolic pathways
rec01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rec00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RHECIAT_CH0002994 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RHECIAT_CH0002994 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    RHECIAT_CH0002994 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rec01011]
    RHECIAT_CH0002994 (ddlB)
Enzymes [BR:rec01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RHECIAT_CH0002994 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:rec01011]
 Precursor biosynthesis
  Amino acid ligase
   RHECIAT_CH0002994 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp ATP-grasp_3 GARS_A Arg_repressor
Motif
Other DBs
NCBI-ProteinID: ACE91943
UniProt: B3PTV6
LinkDB All DBs
Position
complement(2995926..2996852)
Genome map
AA seq 308 aa AA seqDB search
MSRKHVAVLMGGFSSERPVSLSSGKACAEALEAEGFKVTCIDVARDVSEKLAALKPDVVF
NALHGPFGEDGTIQGILEYLEIPYTHSGVLASALAMDKDKAKLVAAAAGIPVAESQVINR
FAFPSTHPMKPPYVVKPVREGSSFGVVIVAEDQAHPPQVVSSPEWHYGEDVLVERYVYGR
ELTCGVMGDVALGVTEVVPQGHNFYDYDSKYAAGGSKHVIPAKISPNIYQKIQTLALRAH
QAIGCRGVSRSDFRYDDRFSEDGEIIWLEVNTQPGMTPTSLVPEMAGHAGYSFGEFLRWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcaagcatgtcgctgtcctgatgggcggattttcctcggaacggcccgtcagc
ctttcctcgggaaaggcttgcgcagaagccctcgaagccgaaggcttcaaggtgacatgc
atcgatgtcgcgcgcgacgtttccgaaaagcttgcggcgctgaagcccgatgtcgtcttc
aatgcgcttcacggaccctttggtgaggatggcaccattcagggcatcctcgaatatctc
gagatcccctatacacattcgggtgtgcttgcctcggcgctggcgatggacaaggacaag
gcgaagctcgtcgctgccgctgccggcattccggttgccgaatcacaggttatcaatcga
ttcgcctttccttcgacgcatccgatgaagccgccctatgtggtgaagccggttcgcgag
gggtcgagcttcggcgtcgttatcgttgccgaagatcaggcgcatccgccgcaggtcgtc
agctcgcccgagtggcattatggcgaggatgtcctcgtcgagcgctacgtctacggccgc
gagctcacctgcggcgtcatgggcgacgtcgcgcttggtgtcaccgaggtggtgccgcag
ggacacaatttctatgattacgattccaagtatgcagcgggcggctcaaaacacgtcatc
ccggcaaaaatttcaccgaatatttaccaaaaaatacaaacattggccctaagggcgcat
caggcaatcggttgtcgcggcgtcagtcggtccgactttcgttacgacgatcgtttctcc
gaagacggcgaaatcatctggctggaggtcaatacccagccaggtatgactccaacctcg
ctcgtgcccgaaatggccggccatgccggttattcctttggtgagtttctccggtggatg
gtggaggacgcgtcttgtttgcgttga

DBGET integrated database retrieval system