KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0003242Help
Entry
RHECIAT_CH0003242 CDS       T00720                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00240  Pyrimidine metabolism
rec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rec00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    RHECIAT_CH0003242 (tdk)
Enzymes [BR:rec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     RHECIAT_CH0003242 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: ACE92190
UniProt: B3PV65
LinkDB All DBs
Position
complement(3253209..3253811)
Genome map
AA seq 200 aa AA seqDB search
MAKLYFNYSTMNAGKSTLLLQASYNYQERGMRTVQLIAAFDERAGRGVIGSRIGLEASAI
PFEPHEDLFNLIAGLCGDGAPISCVFVDEAHFMTAVHVWQLARVVDRLGIPVMVYGLRTD
FQGKLFPASQELLAIADEMREVRTICHCGRKATMVVRLDAQGKVLHEGAQIDVGGNEKYV
SLCRRHWDDEMNGAWIAEPV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttcaactattcgacaatgaacgccggcaagtcgacgctgctgctg
caggcctcctataattatcaagagcgcggcatgcgtacggtgcagttgatcgccgccttc
gacgagcgcgccggccggggcgtgatcggctcgaggatcgggctggaagcgagcgctatt
cccttcgagccgcatgaagatctgttcaatctcatcgccggtctatgcggcgacggggcg
ccgatttcctgcgtcttcgttgatgaggcgcatttcatgacggccgtccatgtctggcag
ctggcccgtgtcgtcgatcggctcggcatccctgttatggtctatgggctccggaccgac
ttccagggcaaattgtttccggcctcgcaggagctgctggcgatcgccgacgagatgcgc
gaagtgcgcacaatctgccattgcggccgtaaggcgacgatggtggtgcggctcgacgcc
caaggcaaggtgctgcacgagggtgcgcagatcgatgtcggcggcaacgagaaatatgtt
tcgctctgccgcaggcactgggacgacgaaatgaacggggcctggatcgccgagccggtc
tga

DBGET integrated database retrieval system