KEGG   Rhizobium etli CIAT 652: RHECIAT_PA0000197Help
Entry
RHECIAT_PA0000197 CDS       T00720                                 

Definition
(GenBank) putative ATP-dependent DNA ligase protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rec00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    RHECIAT_PA0000197
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rec03400]
    RHECIAT_PA0000197
Enzymes [BR:rec01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RHECIAT_PA0000197
DNA repair and recombination proteins [BR:rec03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     RHECIAT_PA0000197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ACE93541
UniProt: B3Q1I5
LinkDB All DBs
Position
pA:complement(211775..214423)
Genome map
AA seq 882 aa AA seqDB search
MASDKLSSYRSKRDFQKTAEPSGERSLKQSNRRRFVIQKHDATRLHYDLRLELDGVFKSW
AVTKGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVMLWDRGYWEPEGRKSPE
QALSKGDFKFTLEGERLHGSFVLVRMRNDRERSKRTNWLLIKHHDEFSVDENGAAILEEN
VTSVASGRSMEMIAAGKGRKPKPFMVEGGKVQADAVWDSNHGLAAEERQSEASAGKRAGT
ATAVDLPDFIAPQLCEKVERPPGGDGWIHEIKFDGYRIQMRVLDGEVTLKTRKGLDWTTK
YPEIAEAASGLPGCILDGEICALDEQGAPNFAALQAALSEGKTASLVYFAFDLLYDGGED
LRSKPLIERKRRLQELLTEAGNDPRIRYVEHFETGGDAVLRSACKLSLEGIISKQTDDPY
QSGRTESWAKSKCRAGHEVVIGAYAKTNGRFRSLLAGVFRGDHFVYVGRVGTGYGAKKVE
TLLPKLKALETARSPFTGIGAPKKQAEVVWVKPELVAEIEFEGWTADGLVRQAAFKGLRE
DKPAREVEAEPPVRPAKADIAEPVPRAKQTPARRKGAKADVMGVLISNPDKPLWPDANGS
EPITKEELAGYYEAVGDWMIHHIKGRPCSIIRAPDGVGGEQFFQRHAMPGQSNLLDLVKV
FGDKKPYLQIDRIEGLAAVAQIAAVELHPWNCEPGQPEVPGRLVFDLDPGPDVPFATVVA
AAREMRDRLENLGLISFCKTTGGKGLHVVTPLAVNKRKPLSWPEAKAFAHDVCQQMARNN
PDLYLIKMTKSLRGGRIFLDYLRNDRMATAVAPLSPRARPGATVSMPLTWTQVKSDLDPK
RFTIRTVPALLSKSSAWKDYCEGQRPLEQAIKRLGRAGKHAA
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgacaagctatcaagctaccgatcaaaacgcgattttcagaagaccgctgag
cccagcggcgagcggtccctcaaacagagcaaccgccgtcgctttgtcatccagaagcac
gatgcgacacggctgcactacgacctgcggctcgagctcgatggcgtgttcaagagctgg
gccgtcaccaaagggccatcgctcgatccgcacgacaagcgactggcggtcgaggtcgag
gaccatcccctcgattatggcgacttcgaaggcactattccgaaaggccagtatggcggc
ggcacggtcatgctgtgggatcgcggctattgggagccggagggcaggaagagcccggag
caggcgctttccaagggtgatttcaagttcacgctcgaaggcgagcgcctgcacgggagc
ttcgtgctggtgcgcatgcgcaacgatcgcgagcgcagcaagcgtaccaactggctgttg
atcaagcatcatgacgagttctccgtggacgagaacggtgctgccatcctcgaagaaaac
gtcacctcggtagcctcaggccgcagcatggaaatgatcgcagccggcaaggggcgcaag
ccgaaacccttcatggtggagggcggcaaggtccaggcggacgccgtctgggacagcaat
cacggactggccgccgaggagcggcagtcggaggcgagtgcgggaaagcgcgccggtact
gcgacggcggttgatcttccggatttcatcgcgccgcaactctgcgagaaggtcgagcga
ccgcctggcggggacggttggatccatgagatcaagttcgacggatatcgcattcagatg
cgcgtgctcgatggcgaagtcaccttgaagaccaggaaaggcctcgactggacgaccaag
taccccgaaatcgccgaggcggcgtctgggcttccgggttgtatcctcgatggcgagatt
tgcgctctcgacgagcaaggtgcgcctaacttcgcggcactccaggcggcgctatcggag
ggcaagaccgccagcctcgtctacttcgccttcgacctgctctatgacggcggcgaggat
ctccggtcgaagcccctgatcgagcgaaagaggcgattgcaggagctcctcaccgaggcc
ggcaacgatcctcggatccgctacgtcgaacatttcgagaccggcggtgacgccgtcctc
agatcggcatgcaagctctcgctggaaggcatcatctcaaaacagacagatgacccctat
caatccggacgaacggaaagctgggcaaagtcaaaatgccgggcggggcacgaggtggtg
atcggcgcctacgccaaaaccaacggcaggtttcgttcccttctcgccggtgtttttcgc
ggcgatcattttgtctatgtcggccgtgtcggaaccggctacggcgccaagaaagtcgaa
acgttgcttccgaaactgaaggcgctggagacggcgagatcgcccttcacgggtatcggt
gctccgaagaagcaggccgaggtcgtctgggtaaagccggagcttgtcgccgaaattgaa
ttcgaggggtggacagcggacggtctcgtccgccaagcagccttcaaaggattgcgcgaa
gataagcctgctcgggaagtcgaggcggagccaccggtaagacccgccaaagcggacatc
gcggagccggttccgagggccaagcaaacaccggcgcgccgcaagggtgcgaaggctgat
gtcatgggagtgctcatctcaaacccggacaaaccattgtggccggatgccaacggcagc
gaaccgatcacgaaggaagaattggcgggctattacgaggcagtcggcgactggatgatc
caccacatcaagggcaggccctgctctatcatccgcgccccggatggagttggcggcgag
cagttctttcagcgccatgcgatgccgggacaatcgaacctgctcgacctggtcaaggtg
ttcggggacaaaaagccatacctgcagatcgatcgcatcgaaggccttgccgcggtcgcc
cagatcgcagcggtcgaactccatccgtggaattgcgaacccggtcaaccggaagttcct
ggtcgtctggtgttcgacctcgatcccgggcctgacgttccctttgccacggtcgttgcc
gctgcccgcgaaatgcgcgatcggctggaaaacctcggactgatcagcttttgcaagacg
acgggcggcaagggcctgcatgtcgtgaccccgcttgcggtcaataagcgcaagccgctt
tcatggcccgaggcaaaggctttcgcgcatgacgtctgccagcagatggcccggaacaac
cccgatctctaccttatcaagatgacgaagagcctgaggggcggtcgcattttcctcgat
tacctgcgtaatgatcgcatggcgacggccgtagcgccgctttctcctcgagcccgcccc
ggtgcgacggtatcaatgcctctgacgtggacgcaggtgaaatcagatctcgaccctaaa
aggttcacgatccgaaccgtacctgccttgctatcgaagtcgtccgcctggaaggattat
tgtgaggggcagcgtcccttggagcaggcgatcaagaggctcggccgcgccggcaagcat
gccgcgtaa

DBGET integrated database retrieval system