KEGG   Roseibacterium elongatum: roselon_02000Help
Entry
roselon_02000     CDS       T03060                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
red  Roseibacterium elongatum
Pathway
red00240  Pyrimidine metabolism
red01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:red00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    roselon_02000
Enzymes [BR:red01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     roselon_02000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: AHM04353
UniProt: W8RT74
LinkDB All DBs
Position
complement(1913346..1914065)
Genome map
AA seq 239 aa AA seqDB search
MALEIAFGRVAHALPPVSIPRTKPCLGGMVNLAGGGPLRHKPVMAKLYFHYSTMNAGKST
LLLQASYNYNERGMQTYLLTARFDDRAGAGKIGSRIGIEAEADTYTADDDLFAKIEVRLS
AGPCACVLIDEAQWMTRAQVWQLARAVDDLGVPVMAYGLRVDFRGELFPGSAALLALADE
MREVRTICHCGKKATMVIRVDDSGAALTEGDQIEVGGNDRYVALCRRHFREAVGDRPPR
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgagatagcctttggccgcgtcgcccatgccctgccccctgtctcgatcccg
cgcacaaaaccgtgtttgggcggcatggtcaatcttgcaggcggcgggcccctgcggcac
aagccggtcatggccaagctgtactttcactactcgacgatgaatgcaggcaaatccacc
ctgcttctgcaagcgtcctacaactacaacgaacgtggcatgcagacctacctgctgacc
gcgcggttcgatgaccgggccggtgccggcaaaatcggcagccgcatcggcatcgaggcc
gaggccgacacctacaccgccgatgacgacctgttcgcgaagatcgaggtgcggctttcg
gccggaccttgcgcctgtgtcctcatcgatgaggcccagtggatgacccgtgcgcaagtc
tggcaactggcccgtgcggtggacgatctgggcgtgccggtgatggcctacgggttgcgc
gtggatttccggggcgagttgttccccggctcggccgcgctgttggcgctggccgacgaa
atgcgcgaggtgcgcacgatctgccattgcggcaagaaggccacgatggtcattcgggtc
gatgacagcggggcggccctgaccgagggcgaccagatcgaggtcggcggcaacgatcgc
tatgtcgccctgtgtcgtcgccatttccgcgaagccgtcggggaccgtccgccgcgctga

DBGET integrated database retrieval system