KEGG   Roseibacterium elongatum: roselon_02216Help
Entry
roselon_02216     CDS       T03060                                 

Definition
(GenBank) 4-carboxymuconolactone decarboxylase
  KO
K01607  4-carboxymuconolactone decarboxylase [EC:4.1.1.44]
Organism
red  Roseibacterium elongatum
Pathway
red00362  Benzoate degradation
red01100  Metabolic pathways
red01120  Microbial metabolism in diverse environments
red01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:red00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    roselon_02216
Enzymes [BR:red01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.44  4-carboxymuconolactone decarboxylase
     roselon_02216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CMD
Motif
Other DBs
NCBI-ProteinID: AHM04554
UniProt: W8RTL1
LinkDB All DBs
Position
complement(2142680..2143069)
Genome map
AA seq 129 aa AA seqDB search
MGTFDEDLFEKGMERRKATLGEDYVAKSFESADDLTQGFQEAMTAWAWGFGWGDDAIDAK
TRSLMNLSMLGALGKMHEWEIHCRGAIRNGVTRDQIRAAVHVVAIYCGVPQAHECFRVAR
KVLAEEGML
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgttcgacgaggatctgttcgaaaaggggatggaacggcgcaaggccacgctt
ggcgaagattatgtcgccaaaagcttcgagagcgccgacgacctgacccaaggctttcaa
gaggcgatgaccgcctgggcctggggctttggctggggcgatgacgccatcgacgccaag
acccgtagcctgatgaacctgtccatgctgggcgcgctggggaagatgcacgaatgggaa
atccattgccgcggcgcgatccgcaatggcgtcacccgcgaccagatccgcgccgccgtg
catgtcgtcgcgatctattgcggcgtgccgcaggcgcatgaatgtttccgtgtcgcccga
aaggttctggccgaggaagggatgctctga

DBGET integrated database retrieval system