KEGG   Roseibacterium elongatum: roselon_02435Help
Entry
roselon_02435     CDS       T03060                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
red  Roseibacterium elongatum
Pathway
red00061  Fatty acid biosynthesis
red00780  Biotin metabolism
red01100  Metabolic pathways
red01130  Biosynthesis of antibiotics
red01212  Fatty acid metabolism
Module
red_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:red00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    roselon_02435
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    roselon_02435
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    roselon_02435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:red01004]
    roselon_02435
Enzymes [BR:red01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     roselon_02435
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     roselon_02435
Lipid biosynthesis proteins [BR:red01004]
 Fatty acid synthase
  Component type
   roselon_02435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1949
Motif
Other DBs
NCBI-ProteinID: AHM04760
UniProt: W8SQD8
LinkDB All DBs
Position
2339145..2339933
Genome map
AA seq 262 aa AA seqDB search
MTDLMKGKRGLVMGVANERSIAWGIARAMADEGAELAFSYQGEAFGKRVEPLAASVGASL
LVDVDVTDDASMDAAFDRIKAEWGTLDFVVHAIAYSDKAELTGRFINTTRENFRNSLTIS
CYSFIDVAKRASELMPVGGSMITLTYQGSNRVTPFYNVMGVAKAALESSVRYLANDLGPQ
KIRVNAISPGPMKTLAGAAIGGARKTFKTTEANAPLRANATLEAVGGTAVYLASDYGACT
TGEIIAVDGGYHVLGMAQPENL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttgatgaagggcaagcgcggccttgtgatgggcgtcgcgaatgagcgctcg
atcgcttggggcatcgcccgcgcgatggccgacgaaggggccgaattggcgttttcctat
cagggcgaggcgttcggcaagcgggtcgagcccctggccgcgtccgtcggcgcaagcctg
ctggtcgatgtggacgtgaccgacgacgcctcgatggatgccgcgttcgaccggatcaag
gcggaatgggggaccctcgatttcgtggtccatgccatcgcatattccgacaaggcggaa
ctgacggggcgcttcatcaacaccacgcgcgagaatttccgcaattcgctgacgatcagc
tgttattccttcatcgacgtggccaagcgcgcctcggagttgatgcccgtgggcgggtcg
atgatcacgctgacctaccaggggtcgaaccgggtgacgccgttctacaacgtgatgggc
gtggccaaggcggcgctcgaaagctcggtgcgctatcttgccaacgacctcgggccgcag
aagatccgcgtcaacgcgatctctccggggccgatgaagacgctggcgggggccgccatc
ggcggcgcacgcaagaccttcaagacaaccgaggccaacgcgccgctgcgcgccaacgcg
acgctcgaggcagtgggcggcaccgcggtttatctggcgtccgattacggggcctgcacc
acgggcgagatcatcgcggtcgatggcggctatcacgtgctgggcatggcgcagcccgaa
aacctgtga

DBGET integrated database retrieval system