KEGG   Roseibacterium elongatum: roselon_02436Help
Entry
roselon_02436     CDS       T03060                                 

Definition
(GenBank) Dimethylsulfoniopropionate (DSMP) lyase DddL
  KO
K16953  dimethylpropiothetin dethiomethylase [EC:4.4.1.3]
Organism
red  Roseibacterium elongatum
Pathway
red00920  Sulfur metabolism
red01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:red00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    roselon_02436
Enzymes [BR:red01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.3  dimethylpropiothetin dethiomethylase
     roselon_02436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DMSP_lyase Cupin_7 Cupin_2
Motif
Other DBs
NCBI-ProteinID: AHM04761
UniProt: W8S740
LinkDB All DBs
Position
2340086..2340628
Genome map
AA seq 180 aa AA seqDB search
MREELSRIIAANPPITPRAISQKPVTAHFSRALDTGERGSMQGMARALREQRDRLTWEYG
YDKVPPALARKYAYCEILGPRGPIAWDRLILGFVLFAPRTTYPQHSHSEIEESYISVSGA
WSENNAAVYAPGSLILNRPGDEHRITIGDQEPCLLAYAWAGPADKLSDPKMKFTAGRRQV
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgaggagttgtcgcggatcatcgcggccaatccgccgattaccccgcgcgcaatc
agccaaaagccggtcacggcgcatttctcgcgggcgctggacaccggcgagcgcggctcg
atgcaggggatggcgcgcgcattgcgcgaacaacgcgaccggctgacatgggaatacggc
tatgacaaggtgccgccggcgctggcccggaaatacgcctattgcgagatcctggggccg
cgcggcccgatcgcgtgggatcgtctgatcctcggcttcgtgctgttcgcgccgcgcacc
acctatccgcagcacagtcattccgagatcgaggaaagctatatttcggtctcgggggca
tggtcggaaaacaacgccgccgtctatgcaccgggttcgttgatcctgaaccgccccggc
gacgagcaccgcatcaccatcggcgatcaggagccctgcctgctggcttatgcctgggcg
gggccggcggacaaactgagcgatcccaagatgaaattcaccgccggacgacgtcaggtt
tga

DBGET integrated database retrieval system