KEGG   Raoultella electrica: electrica_03683Help
Entry
electrica_03683   CDS       T06174                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ree  Raoultella electrica
Brite
KEGG Orthology (KO) [BR:ree00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    electrica_03683 (ahpF)
Enzymes [BR:ree01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     electrica_03683 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like Thi4 DAO NAD_binding_8 K_oxygenase FAD_binding_3 AlaDh_PNT_C FMO-like Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: QDI09754
UniProt: A0A514EUL5
LinkDB All DBs
Position
complement(3808854..3810419)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELVATLDDSAKSAEIKELLAEIAELSAKVTFREDNSLPV
RKPSFLIANPGSLQGPRFAGSPLGHEFTSLVLALLWTGGHPSKETQSLLEQIRDLDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFMNGQE
FGQGRMTLAEIVAKVDTGAEKRAAEELNKRDAYDVLIVGSGPSGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYAVDVIDSQSAAKLIPAAVEG
GLHQIETASGAVLKARSVIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGLVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVTGD
GSKVTGLQYRDRVSGDEHHIGLAGIFVQIGLLPNTNWLEGAIERNRMGEIIIDAKCETNV
KGVFAAGDCTTVPYKQIIIAAGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaacatgaaaacccagctcaaggcctaccttgagaaactgacgaaacct
gttgagctggttgccacgctggatgacagcgcaaaatcggcagaaatcaaggaactgctg
gctgaaattgccgaactgtcggcaaaagtgaccttcagagaagataacagcttgcctgtc
cgcaagccctctttcctgatcgcgaaccccggttcccttcaggggccgcgctttgccggt
tccccgctgggacatgaatttacctctttggtgctggcgctgctgtggaccggcggtcat
ccgtccaaagagacccagtcgctgctcgagcagatccgcgatctggacggtgattttgag
tttgaaacctattactcgctctcttgccataactgcccggatgtcgtgcaggcgctgaac
ctgatggcggtactgaatccgcgtatcaaacatacggcgattgacggcgggactttccag
aatgagattaccgatcgcaacgtgatgggcgtcccggcggtctttatgaatggccaggag
ttcggtcaggggcgtatgacgctggcggaaattgtcgctaaagtcgataccggtgccgaa
aaacgggcggcggaagagctgaataaacgcgatgcttatgatgtgctgattgtcggttcc
ggtccgtcaggcgccgctgcggcggtctattctgcgcgtaaaggcattcgtaccggcctg
atgggtgaacgtttcggtggtcaggtgctggataccgtggatatcgaaaactacatctct
gtgccgaaaacggaagggcagaagctggccggggcgttaaaagcgcacgtcagcgactat
gctgtggatgtgattgactctcagagcgcagcgaaactgattccggctgcggtagaaggc
ggcctgcatcaaattgaaacggcctccggcgcggtgctgaaagcgcgcagcgtaatcatt
gccaccggggcaaaatggcgcaacatgaacgtgccgggtgaagatcagtatcgcaccaaa
ggggtgacctattgcccgcactgcgacggcccgctgtttaaaggtaaacgcgtggcggtc
atcggcggcggtaactccggcgttgaggcggccatcgatctggcgggcctggtagaacac
gtgaccctgctggagttcgccccggagatgaaagccgaccaggtcctgcaggataaagtc
cgcagcctgaaaaacgtcgatatcattctcaacgctcagaccactgaagtcacgggcgat
ggcagcaaagtgaccggcctgcagtatcgtgaccgggtcagcggggatgagcaccatatc
gggctggcggggattttcgtgcagattgggctgttgccgaacaccaactggctggaaggc
gccatcgagcgcaaccggatgggggaaattatcatcgacgcgaaatgtgaaacaaacgtc
aagggcgtatttgccgccggcgactgcacaaccgtaccgtacaaacagatcattatcgct
gcgggcgaaggggcgaaagcttcgctgagttcgttcgattatctgattcgtaccaaaacc
gcataa

DBGET integrated database retrieval system