KEGG   Cupriavidus necator H16: H16_A0610Help
Entry
H16_A0610         CDS       T00416                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
reh  Cupriavidus necator H16
Brite
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     H16_A0610 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAJ91758
UniProt: Q0KE13
LinkDB All DBs
Position
1:643332..643913
Genome map
AA seq 193 aa AA seqDB search
MEHKLPPLPYAHDALAPHISKETLEFHHDKHHQTYVTNLNNLIKGTEFENSTLEEIVKKS
SGGIFNNAAQVWNHTFYWDSMKPNGGGQPTGALADAINAKWGSFDKFKEEFTKTAVGTFG
SGWAWLVKKADGSLDLVSTSNAATPLTTDAKALLTCDVWEHAYYIDYRNARPKYVEAFWN
VVNWDFAGKNFAG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaacacaagctccccccgctgccgtacgcgcatgatgccctggctccgcatatctcc
aaggagacgctggagttccatcatgacaagcaccaccagacctacgtcaccaacctgaac
aacctcatcaagggcaccgagttcgagaactcgaccctggaagagatcgtcaagaagtcg
tcgggcggtatcttcaacaacgctgcccaggtgtggaaccacaccttctactgggattcg
atgaagcccaacggcggcggccagccgaccggcgcgctggctgatgccatcaacgccaag
tggggctcgttcgacaagttcaaggaagagttcaccaagaccgccgtgggcaccttcggt
tcgggttgggcctggctggtcaagaaggccgacggctcgctggacctggtctcgacctcc
aacgccgccaccccgctgaccaccgacgccaaggcgctgctgacctgcgacgtgtgggaa
cacgcctactacatcgactaccgcaatgcccgcccgaagtacgtcgaggcattctggaat
gtcgtgaactgggacttcgccggcaagaatttcgctggctga

DBGET integrated database retrieval system