Cupriavidus necator H16: H16_A0705 Help Entry H16_A0705         CDS       T00416                                  Symbol groES Name (GenBank) Co-chaperonin GroES (HSP10)   KO K04078   chaperonin GroES Organism reh  Cupriavidus necator H16 Brite KEGG Orthology (KO) [BR:reh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:reh03110]     H16_A0705 (groES)    03029 Mitochondrial biogenesis [BR:reh03029]     H16_A0705 (groES) Chaperones and folding catalysts [BR:reh03110]  Heat shock proteins   HSP10    H16_A0705 (groES) Mitochondrial biogenesis [BR:reh03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     H16_A0705 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  CAJ91853 UniProt:  Q0KDR8 LinkDB All DBs Position 1:761741..762031 Genome browser AA seq 96 aa AA seqDB search MNLRPLHDRVIVKRLDNETKTASGIVIPDNAAEKPDQGEVLAIGPGKKDDKGNNIALDVK VGDRVLFGKYAGQAVKVEGQELLVMREEDIMAVVNK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaatctgcgtcctttgcacgaccgcgtgatcgtgaagcgtctggacaacgaaaccaag accgcgtccggtatcgtgattcccgacaacgctgccgagaagcccgatcaaggcgaagtg ctggcaatcggtcctggcaagaaggatgacaagggcaacaacatcgccctcgacgtcaag gtcggtgaccgcgtgctgttcggcaagtacgccggccaggccgtgaaggtggaaggccag gaactgctggtcatgcgcgaagaagacatcatggccgtggtgaacaagtaa

DBGET integrated database retrieval system