KEGG   Cupriavidus necator H16: H16_B0571Help
Entry
H16_B0571         CDS       T00416                                 

Gene name
h16_B0571
Definition
(GenBank) Glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
reh  Cupriavidus necator H16
Brite
KEGG Orthology (KO) [BR:reh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    H16_B0571 (h16_B0571)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     H16_B0571 (h16_B0571)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: CAJ95368
UniProt: Q0K3Q6
LinkDB All DBs
Position
2:643188..643892
Genome map
AA seq 234 aa AA seqDB search
MPDLSAFPITRKWPAQHPDRIQLYSLPTPNGVKVSIMLEETGLPYEPHLVRFDANDQMSP
EFLSLSPNNKIPAILDPNGPGGKPLALFESGAILLYLADKSGQLIPADPARRYETIQWVM
FQMGGIGPMFGQVGFFHKFAGKEYEDKRPRDRYVAESRRLLNVLNQRLEGRDWIMGDTYT
IADIATFPWVRNLLGFYEAGELVGIQDFPHVRRVLEAFVKRPAVVKGLDTPHRG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgatctgtccgctttccccatcacccgcaaatggccggcgcagcatcccgaccgc
atccagctgtattccctgcccacgcccaacggggtcaaggtgtcgatcatgctggaggag
accggcctgccgtatgaaccgcacctggtgcgcttcgacgccaacgaccagatgtcgccg
gagttcctgtcgctgagcccgaacaacaagattcccgccatcctcgatcccaacggtccg
ggcggcaagccgctggcgctgttcgaatcgggcgcgatcctgctctacctggccgacaag
tcgggccagctgatcccggccgaccccgcgcgccgctacgaaaccatccagtgggtgatg
ttccagatgggcggcatcgggccgatgttcgggcaggtgggctttttccacaagttcgcg
ggcaaggagtacgaggacaagcgcccgcgcgaccgctacgtggccgaaagccggcgcctg
ctgaatgtgctgaaccagcggctggaagggcgcgactggatcatgggcgacacctacacc
attgccgatatcgccaccttcccgtgggtgcgcaacctgcttggcttctatgaggcgggc
gaactggtcggcatccaggacttcccgcatgtcaggcgcgtgctggaggccttcgtgaag
cgcccggcggtggtgaaggggctcgatacgccgcaccgcggctga

DBGET integrated database retrieval system