KEGG   Cupriavidus necator H16: H16_B1110Help
Entry
H16_B1110         CDS       T00416                                 

Gene name
h16_B1110
Definition
(GenBank) Copper-Zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
reh  Cupriavidus necator H16
Brite
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     H16_B1110 (h16_B1110)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu RskA Big_3_5
Motif
Other DBs
NCBI-ProteinID: CAJ95901
UniProt: Q0K273
LinkDB All DBs
Position
2:complement(1257539..1258111)
Genome map
AA seq 190 aa AA seqDB search
MKQVLPPLAACIAATIALAGCAGSGMSSSSAASASGTSASSSARAAATLQPKSGSNTGGT
VTFQQQPGGVMMTAAITGLPPNSVHGFHVHEKGDCSAPDAMSAGGHFNPTGKPHGQMTMP
DHHAGDMNNVTADASGNVRVSMLLPDLTVGTGANGVIGRAVVVHKDPDDYKTQPTGNAGG
RIACGVVAAS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagtgcttccccccctggcggcctgcatcgccgcgaccattgcactggccggc
tgcgccggctccggcatgagctcctcgtctgcggccagcgcgtccggcaccagcgccagc
agcagcgccagggcggcggccacgctccagcccaagagcggcagcaatactggcggcacc
gtgaccttccagcagcagcccggcggcgtgatgatgactgcggcgatcaccggcctgccg
cccaactccgtgcacggcttccacgtccatgagaagggcgactgctccgcgcctgacgcg
atgagcgcgggcggccacttcaacccgaccggcaagccccacggccagatgaccatgccc
gaccaccatgccggcgacatgaacaacgtcaccgcggacgccagcggcaacgttcgcgtc
agcatgctgctgccggacctgaccgttggcacgggcgccaacggggtgatcggccgcgcg
gtggtggtacacaaggatccggacgactacaagacgcagccgaccggtaatgcgggcggg
cggattgcttgcggggttgtcgcggcttcgtaa

DBGET integrated database retrieval system