KEGG   Cupriavidus necator H16: H16_B1394Help
Entry
H16_B1394         CDS       T00416                                 

Gene name
cbbS2
Definition
(GenBank) ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
reh  Cupriavidus necator H16
Pathway
reh00630  Glyoxylate and dicarboxylate metabolism
reh00710  Carbon fixation in photosynthetic organisms
reh01100  Metabolic pathways
reh01120  Microbial metabolism in diverse environments
reh01200  Carbon metabolism
Module
reh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
reh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:reh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    H16_B1394 (cbbS2)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    H16_B1394 (cbbS2)
Enzymes [BR:reh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     H16_B1394 (cbbS2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: CAJ96183
UniProt: Q0K1E1
LinkDB All DBs
Position
2:complement(1560986..1561405)
Genome map
AA seq 139 aa AA seqDB search
MRITQGTFSFLPDLTDAQITSQLEYCLNQGWAVGIEYTDDPHPRNTYWEMFGLPMFDLRD
AAGILLEINNARSTFPNHYIRVTAFDSTHTVESVVMSFIVNRPADEPGFRLVRQEEPGRT
MRYSIESYAVQARPEGSRY
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattactcaaggcactttctccttcctgcccgacctcaccgacgcgcagatcacc
agccagcttgaatactgcctgaaccagggctgggcggtcggcatcgagtacaccgacgac
ccgcatccgcgcaatacctactgggagatgttcggcctgccgatgttcgacctgcgcgat
gccgccggcatcctgctggagatcaacaacgcgcgcagcaccttccccaaccactacatc
cgcgtcacggccttcgattcgacgcatacggtggagtcggtggtgatgtcgttcatcgtc
aaccgtcctgcggacgagcccggcttccgcctggtgcgacaggaagagcccggccgcacc
atgcgctactcgatcgagagctacgctgtgcaggcacgccccgagggcagccgctactga

DBGET integrated database retrieval system