KEGG   Cupriavidus necator H16: H16_B1395Help
Entry
H16_B1395         CDS       T00416                                 

Gene name
cbbL2
Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
reh  Cupriavidus necator H16
Pathway
reh00630  Glyoxylate and dicarboxylate metabolism
reh00710  Carbon fixation in photosynthetic organisms
reh01100  Metabolic pathways
reh01120  Microbial metabolism in diverse environments
reh01200  Carbon metabolism
Module
reh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
reh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:reh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    H16_B1395 (cbbL2)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    H16_B1395 (cbbL2)
Enzymes [BR:reh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     H16_B1395 (cbbL2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: CAJ96184
UniProt: Q0K1E0
LinkDB All DBs
Position
2:complement(1561463..1562923)
Genome map
AA seq 486 aa AA seqDB search
MNAPESVQAKPRKRYDAGVMKYKEMGYWDGDYEPKDTDLLALFRITPQDGVDPVEAAAAV
AGESSTATWTVVWTDRLTACDMYRAKAYRVDPVPNNPEQFFCYVAYDLSLFEEGSIANLT
ASIIGNVFSFKPIKAARLEDMRFPVAYVKTFAGPSTGIIVERERLDKFGRPLLGATTKPK
LGLSGRNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLFVMDAVNKASAATGEVKG
SYLNVTAGTMEEMYRRAEFAKSLGSVIIMIDLIVGWTCIQSMSNWCRQNDMILHLHRAGH
GTYTRQKNHGVSFRVIAKWLRLAGVDHMHTGTAVGKLEGDPLTVQGYYNVCRDAYTHADL
SRGLFFDQDWASLRKVMPVASGGIHAGQMHQLISLFGDDVVLQFGGGTIGHPQGIQAGAT
ANRVALEAMVLARNEGRDILNEGPEILRDAARWCGPLRAALDTWGDISFNYTPTDTSDFA
PTASVA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacctgaatcggtccaagccaagccgcgcaagcgctacgacgccggcgtcatg
aagtacaaggaaatggggtactgggacggcgactacgagcccaaggataccgacctgctg
gcgctgttccgcatcacgccgcaggacggcgtggatccggtcgaggccgccgccgcggtt
gccggcgagtcctccaccgccacctggacggtggtgtggaccgaccgcctgaccgcctgc
gacatgtaccgtgccaaggcctaccgggtcgacccggtgcccaacaaccccgagcagttc
ttctgctacgtggcctatgacctgtcgctgttcgaggaaggctcgatcgccaacctgacc
gcgtcgatcatcggcaacgtcttcagcttcaagccgatcaaggcggcgcgcctggaagac
atgcgcttcccggtcgcctacgtgaagaccttcgccggcccgtccaccggcatcatcgtc
gagcgcgagcgcctggacaagttcggccgtccgctgctgggcgccaccaccaagcccaag
ctgggcctgtcgggccgcaactacggccgcgtggtgtatgagggcctgaagggcgggctg
gacttcatgaaggatgacgagaacatcaactcgcagcccttcatgcactggcgcgaccgc
ttcctgttcgtgatggacgcggtcaacaaggcctcggcggcaaccggcgaggtcaagggc
agctacctcaacgtgaccgccggcaccatggaagagatgtaccggcgtgccgagttcgcc
aagtcgctgggctcggtcatcatcatgatcgacctgatcgtcggctggacctgtatccag
tccatgagcaactggtgccgccagaacgacatgatcctgcacctgcaccgcgcgggccat
ggcacctacacccggcagaagaaccacggcgtgtcgttccgcgtgattgccaaatggctg
cgcctggccggtgtcgaccacatgcacaccggcaccgcggtgggcaagctggaaggcgat
ccgctgaccgtgcagggctactacaacgtctgccgcgatgcctacacccatgccgacctg
tcgcgcgggctgttcttcgaccaggactgggcttcgctgcgcaaggtgatgccggtggcc
tcgggcggcatccacgccggccagatgcaccagctgatcagcctcttcggcgacgacgtg
gtgctgcagttcggtggcggcaccatcggccacccgcagggcatccaggccggcgccacc
gccaaccgcgttgcgctggaagcgatggtgctggcgcgcaacgaaggccgcgacatcctc
aacgaagggccggagatcctgcgcgatgccgcgcgctggtgcggaccgctgcgggctgcg
ctcgatacctggggcgacatcagcttcaactacacgccgaccgacacctcggacttcgcg
cccaccgcgtcggtggcctga

DBGET integrated database retrieval system