KEGG   Cupriavidus necator H16: H16_B1558Help
Entry
H16_B1558         CDS       T00416                                 

Gene name
h16_B1558
Definition
(GenBank) two domain protein: Trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
reh  Cupriavidus necator H16
Pathway
reh00500  Starch and sucrose metabolism
reh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    H16_B1558 (h16_B1558)
Enzymes [BR:reh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     H16_B1558 (h16_B1558)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     H16_B1558 (h16_B1558)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 Mak_N_cap
Motif
Other DBs
NCBI-ProteinID: CAJ96345
UniProt: Q0K0X9
LinkDB All DBs
Position
2:1748565..1751924
Genome map
AA seq 1119 aa AA seqDB search
MKRLTETGSAALLNADPLWYKDAIIYQLHIKSFYDANGDGVGDFAGLLAKLDYLVNLGVD
TVWLLPFYPSPRRDDGYDIADYRNVHPDYGTLAEARRFIAAAHARGLRVITELVINHTSD
QHPWFQRARAAKPGSAARRYYVWSDHDQAYAGTRIIFCDTEKSNWSWDPVAGAYFWHRFY
SHQPDLNFDNPQVLNEVLSVMRYWLDMGVDGLRLDAVPYLVEREGTSNENLPETHAVIRH
IRAHLDARFPGRMLLAEANMWPEDAQQYFGLTGPEPEGDECHMAFHFPLMPRMYMAIARE
DRFPITDIMRQTPEVPPNCQWAIFLRNHDELTLEMVTSSERDYLWEVYATDRRARINLGI
RRRLAPLMERDRRRIELMNSLLFSMPGTPVIYYGDEIGMGDNIHLGDRDGVRTPMQWSPD
RNGGFSHADPERLVLPPLQGPLYGYEAVNVEAQARDPHSLLNWMRRMLALRRKHRAFGRG
TLRFLFPGNRKILAYLREYEDEHIMCVANLSRAPQAVELDLSAFNGRVPVEMMGATPFPA
IGTLTYLLTLPPYGFYWFVLSDEAQPPSWHVEAPEQMPDQITLVMQNTSRPELTDASRRI
MASDVLPHYISRRRWFGAKHERIERIDLAYLLPFARGSSGEDVYLGEVEVTLPGRTERYQ
LPLGILWDRESADSVSQLAHGLSMARVRQGSRVGLATDGFVVEPFAREVVRALRNDVQVH
AGNDIIHFRAEAGLAALELERDPIEYMSAEQSNSSLSYNNTAVLKMVRRVSGGIHPEAEM
TRYLTVQGYAHAAPLLGEVVRTGPDGVPHTLMLLQGYVLNQGNGWDWTLDYLGRAIDDAL
PSQESEDEFAEAMNGYAALAGTLGRRLAELHAVLARPSGDDAFAPLPATEGDARAWAEQA
LRALQRALTRLESAPATVPGPVRQGFEADVQTLLAARDALPALVEQLAAAAPGSLQTRIH
GDFHLGQVLIAQNDTYLVDFEGEPGLPLDWRRRKTSPLRDVAGLLRSLDYAAATVGTDRQ
ERTHSELPPQLAERRAVLLERFRSTASEALLNCYHLHMQDSGTPWAAPGQLQPLLDLFLL
ERAAYEVDYEAANRVAWIDLPVSGLARLVRKLLAPGDQP
NT seq 3360 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgccttaccgaaaccggcagtgccgccctgctcaacgccgatccgctctggtac
aaggacgcgatcatctaccagctccacatcaagtccttctacgacgccaacggcgacggc
gtgggcgattttgccgggttgctggccaagctcgactacctggtcaacctgggtgtggac
acggtctggctgctgccgttctatccgtcgccgcgccgcgacgatggctacgacatcgcc
gactaccgcaacgtccaccccgactacggcacgctggccgaggcgcgccgctttatcgcc
gcggcgcacgcgcgcggactgcgcgtgatcaccgagctggtgatcaaccacacctccgac
cagcatccgtggttccagcgcgcgcgcgccgccaagcccggctcggcggcacggcgctac
tacgtgtggtcggaccatgaccaggcctacgccggcacccgcatcatcttctgcgacacc
gagaagtccaactggagctgggacccggtggcgggcgcctacttctggcaccgcttctac
tcgcaccagccggacctgaacttcgacaacccgcaggtgctcaacgaggtgctgtcggtg
atgcgctactggctcgacatgggcgtcgacgggctgcgcctggacgcggtgccctacctg
gtcgagcgcgaaggcaccagcaacgagaacctgcccgagacccatgccgtcatccgccat
atccgtgcccacctggacgcgcgcttccccggccgcatgctgctggcagaagccaatatg
tggccggaggacgcgcagcagtactttggcctgaccgggccggagccggaaggcgacgaa
tgccacatggccttccacttcccgctgatgccgcgcatgtacatggcgatcgcgcgcgaa
gaccgcttcccgatcaccgacatcatgcgccagacgccggaggtgccgcccaactgccag
tgggccatcttcctgcgcaaccatgacgaactgacgctggagatggtgaccagcagcgag
cgcgactacctgtgggaggtctacgccaccgaccggcgcgcccgcatcaacctgggcatc
cgccgccggctggcacccctgatggagcgcgaccgccgccgcatcgagctgatgaacagc
ctgctgttctcgatgccgggcacgccggtgatctactacggcgacgagatcggcatgggc
gacaacatccacctgggcgaccgcgacggcgtgcgcacgccgatgcagtggtcacccgac
cgcaacggcggcttctcgcacgccgaccccgagcgcctggtgctgccgccgctgcaaggc
ccgctgtatggctacgaagccgtcaacgtcgaggcgcaggcgcgcgacccgcattcgctg
ctgaactggatgcggcgcatgctggcgctgcggcgcaagcaccgcgccttcggccgcggc
acgctgcgcttcctgtttccgggcaaccgcaagatcctggcctacctgcgcgaatacgag
gacgagcacatcatgtgcgtggccaacctgtcgcgcgcgccgcaggccgtcgaactggac
ctgtccgccttcaacggccgcgtgccggtggagatgatgggcgccacgccgttcccggcc
atcggcacgctgacctacctgctcacgctgccgccttacggcttctactggttcgtactc
agtgacgaggcgcagcccccgtcatggcacgtggaagcacccgagcagatgccggaccag
atcaccctggtgatgcagaacacgagccggccggagctgaccgacgcctcgcgccgcatc
atggccagcgacgtgctgccgcactacatcagccggcgccgctggttcggcgccaagcac
gagcgcatcgagcgcatcgacctggcgtacctgctgccatttgcgcgcggcagcagcggc
gaagatgtctacctgggcgaggtggaggtgaccctgcctggccgcaccgaacgctaccag
ctgccgctgggcatcctgtgggaccgcgagagcgccgacagcgtgtcgcagctggcacat
ggactgtcgatggcgcgcgtgcgccagggcagccgcgtggggctggccaccgacggtttc
gtggtcgagccctttgcgcgcgaggtggtgcgcgcgctgcgcaatgacgtgcaggtgcac
gccggcaacgacatcatccacttccgcgccgaagccggcctggccgcgctggaactggag
cgcgacccgatcgaatacatgtcggcagagcagtccaacagctcgctgtcctataacaac
accgccgtgctcaagatggtgcgccgggtctctggcggcatccaccccgaggccgagatg
acgcgctacctgaccgtgcagggctatgcgcacgcggcgccgctgctgggcgaggtggtg
cgcaccgggccggatggcgtgccgcatacgctgatgctgctgcagggctatgtcctgaac
cagggcaatggctgggactggaccctggactacctgggccgcgccatcgatgacgcgctg
ccctcgcaggagagcgaggacgagtttgccgaggccatgaacggctatgccgcgctggct
ggcacgctcggccgccggctcgccgaactccatgcggtgctggcacggcccagcggcgac
gacgcgttcgcgccgttgccggccaccgaaggcgatgcgcgcgcgtgggccgagcaagcc
ttgcgtgcgctgcagcgcgccctgacgcggctggagtccgcgcccgccaccgtgccggga
ccggtgcgccagggcttcgaggccgacgtgcagaccctgctggccgcgcgcgacgcgctg
cccgcgctggtcgaacagctcgccgctgccgcgccgggcagcctgcagacacgcatccac
ggcgacttccacctgggccaggtgctgattgcgcagaacgacacctacctggtcgacttc
gaaggcgagcccggcctgccgctggactggcgccggcgcaagacctcgccgctgcgcgat
gtggccgggctgctgcgctcgcttgactacgccgcggccacggtcggcaccgaccgccag
gagcgcacccacagcgaactgccgccgcagctggccgaacgccgcgcggtgctgctggag
cgcttccgcagcaccgccagcgaagccctcctgaactgctaccacctgcacatgcaggac
tcgggcacaccctgggccgcgcccggccagctgcagccattgctggacctgttcctgctg
gaacgggcagcctatgaggtcgactacgaagccgccaaccgcgtggcttggatcgacctg
ccggtcagcggcctggcgcgcctggtgcgcaagctgctggcgccgggagaccagccatga

DBGET integrated database retrieval system