KEGG   Cupriavidus necator H16: H16_B1931Help
Entry
H16_B1931         CDS       T00416                                 

Gene name
icd2
Definition
(GenBank) isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
reh  Cupriavidus necator H16
Pathway
reh00020  Citrate cycle (TCA cycle)
reh00480  Glutathione metabolism
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01120  Microbial metabolism in diverse environments
reh01130  Biosynthesis of antibiotics
reh01200  Carbon metabolism
reh01210  2-Oxocarboxylic acid metabolism
reh01230  Biosynthesis of amino acids
Module
reh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
reh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:reh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    H16_B1931 (icd2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    H16_B1931 (icd2)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     H16_B1931 (icd2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH B12-binding_2
Motif
Other DBs
NCBI-ProteinID: CAJ96713
UniProt: Q0JZW1
LinkDB All DBs
Position
2:complement(2176492..2178729)
Genome map
AA seq 745 aa AA seqDB search
MSTQQPTIIYTLTDEAPLLATSAFLPIIQTFTKPAGINVTTSDISVAGRILGEFPEFLTE
AQRVPDNLAELGKLTQLPDTNIIKLPNISASVHQLVSAIRELQGKGYKVPDYPEDPKNDE
EKAIQKRYSKCLGSAVNPVLREGNSDRRAPAAVKNFARKHPHSMGEWSMASRTHVAHMKH
GDFYHGEKSMTLDRARDVKMELVTKSGKTIVLKPKVSLLDGEIIDSMFMSKKALCDFYEE
QFEDARKTGVMLSLHVKATMMKVSHPIVFGHAVKIFYKEAFAKHGALFDELGVNVNNGLV
NLYEKIEALPSSKREEIIRDLHACHEHRPELAMVDSAKGISNLHAPNDVIVDASMPAMIR
IGGKMWGADGRPKDTKAVIPESTFARIYQEIINFCKTNGNFDPTTMGTVPNVGLMAQKAE
EYGSHDKTFEIAEDGVANIVDLATGEVLLTQDVEQGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAVFWLDPYRPHEAELIKKVETYLKDYDTNGLDIQIMSQVRAMRYTLERVIRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAVSLEDVGIKTGNAKAKILARTLDAATGKLLDNNKSPSPKTGQLDNR
GSQFYLAMYWAQELAGQSEDAELAAKFAPLARTLTDNEQKIVGELGAVQGQPVDIGGYYM
PEADKLSAAMRPSQTLNAALSTVTA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgagtacccagcaacccaccatcatctacacgctgaccgacgaagctccgctgctggcg
accagtgcgttcctcccgatcatccagaccttcaccaagcccgccggcatcaacgtcacc
accagcgacatctcggtggcgggccgtatcctgggcgagttccccgaattcctgaccgaa
gcgcagcgcgtgccggacaacctggccgagctgggcaagctgacccagctgccggacacc
aacatcatcaagctgccgaacatcagcgcctcggtgcaccagctggtcagcgccatccgc
gaactgcagggcaagggctacaaggtgccggactatccggaagatccgaagaacgacgaa
gaaaaggcaatccagaagcgctattccaagtgcctgggctcggccgtgaacccggtcctg
cgcgaaggcaactccgaccgccgcgcaccggcagcggtcaagaacttcgcgcgcaagcac
ccgcacagcatgggcgagtggagcatggcctcgcgcacgcacgtggcgcacatgaagcat
ggcgacttctaccacggcgaaaagtccatgaccctggaccgcgcgcgtgacgtcaagatg
gagctggtcaccaagagcggcaagaccatcgtgctcaagcccaaggtctcgctgctggat
ggcgagatcatcgacagcatgttcatgagcaagaaggcgctgtgcgacttctatgaagag
cagttcgaagacgcgcgcaagaccggcgtgatgctgtcgctgcacgtcaaggcgaccatg
atgaaggtgtcgcacccgatcgtgttcggccacgccgtcaagatcttctacaaggaagcc
ttcgccaagcacggcgcgctgttcgacgaactgggcgtgaacgtcaacaacggcctggtc
aacctgtacgagaagatcgaggcgctgcccagctccaagcgcgaagagatcatccgcgac
ctgcacgcctgccacgagcatcgcccggaactggcgatggtggattcggccaagggcatt
tccaacctgcacgcgcccaacgacgtgatcgtggatgcctcgatgccggccatgatccgc
atcggcggcaagatgtggggtgccgacggccgtccgaaggacaccaaggccgtgatcccg
gaaagcacctttgcccgcatctaccaggagatcatcaacttctgcaagaccaacggcaac
ttcgacccgaccaccatgggcaccgtgcccaacgtgggcctgatggcgcagaaggccgaa
gaatacggctcgcacgacaagaccttcgagatcgccgaagacggcgtcgccaacatcgtc
gacctggccactggtgaagtgctgctgacgcaggacgtcgagcagggcgacatctggcgc
atgtgccaggtcaaggacgcgccgatccgcgactgggtcaagctggccgtgacgcgcgcg
cgcaactcgggcatgccggcggtgttctggctggacccgtaccgtccgcacgaagccgag
ctgatcaagaaggtcgagacctacctgaaggactacgataccaacggcctggacatccag
atcatgtcgcaggtgcgcgccatgcgctacacgctggagcgcgtgatccgcggcctggac
accatctcggtgaccggcaacatcctgcgcgactacctgaccgacctgttcccgatcatg
gaactgggcaccagcgccaagatgctgtcgatcgttccgctgatggccggtggcggcatg
tatgagaccggcgccggcggttcggctccgaagcatgtcaagcaactggtggaagaaaac
cacctgcgctgggattcgctgggcgagttcctggcgctggcggtgtcgctggaagacgtt
ggcatcaagaccggcaatgccaaggccaagatcctggccaggacgctggatgctgccacc
ggcaagctgctggacaacaacaagagcccgtcgcccaagaccggccagctggacaaccgc
ggcagccagttctacctggcgatgtactgggcgcaggaactggccggccagtcggaggac
gccgaactggccgcgaagttcgcgccgctggccaggacgctgaccgacaacgagcagaag
atcgttggcgaactcggcgccgtgcagggccagccggtggatatcggcggctattacatg
ccggaagccgacaagctcagcgccgcgatgcgcccgagccagacgctgaacgccgcgctg
tcgaccgtgacggcctga

DBGET integrated database retrieval system