KEGG   Cupriavidus necator H16: H16_B1960Help
Entry
H16_B1960         CDS       T00416                                 

Gene name
exaC
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
reh  Cupriavidus necator H16
Pathway
reh00010  Glycolysis / Gluconeogenesis
reh00620  Pyruvate metabolism
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H16_B1960 (exaC)
   00620 Pyruvate metabolism
    H16_B1960 (exaC)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     H16_B1960 (exaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: CAJ96742
UniProt: P46368
LinkDB All DBs
Position
2:2212207..2213727
Genome map
AA seq 506 aa AA seqDB search
MNMAEIAQLGVSNPYKQQYENYIGGAWVPPAGGEYFESTTPITGKPFTRVPRSGQQDVDA
ALDAAHAAKAAWARTSTTERANILNRIADRIEANLKLLAVAESIDNGKPVRETTAADLPL
AVDHFRYFAGCIRAQEGGISEIDADTIAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALA
AGNCVVLKPAEQTPASILVLMEVIGDLLPPGVVNVINGFGLEAGKPLASSPRISKVAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFEDVLAADDAFFDKALEGFAMFALNQGEV
CTCPSRALIQESIYDRFMERALKRVAAIRQGHPLDTGTMIGAQASAEQLEKILSYIDLGR
KEGAQCLTGGERNVLDGDLAGGYYVKPTVFAGHNKMRIFQEEIFGPVVSVTTFKDEEEAL
AIANDTLYGLGAGVWTRDGARAFRMGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HRMMLDHYQQTKNLLVSYSPNALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggcggaaatcgcccagctgggcgtcagcaacccctacaagcagcagtacgag
aactacatcggcggcgcctgggtgccgcccgccggcggcgagtacttcgaatcgaccacg
ccgatcaccggcaagccgttcacgcgcgtgccgcgctccggccagcaggatgtcgacgcc
gcgctggacgccgcgcacgccgccaaggccgcgtgggctcgcacctcgaccaccgagcgc
gccaatatcctgaaccgcatcgccgaccgcatcgaggccaacctgaagctgctggccgtg
gccgagagcatcgacaacggcaagccggtgcgtgaaaccaccgccgccgacctgccgctg
gcggtcgaccacttccgctacttcgccggctgcatccgtgcgcaggaaggcggcatctcc
gagatcgacgccgacaccattgcctaccatttccatgagccgctgggcgtggtcggccag
atcatcccgtggaacttcccgctgctgatggccacctggaagctggcgccggcgctggcc
gccggcaactgcgtggtgctcaagcccgcggagcagacgccggcctcgatcctggtgctg
atggaagtgatcggcgacctgctgccgccgggcgtggtcaacgtgatcaacggcttcggc
ctggaagccggcaagccgctggcatcgagcccgcgcatcagcaaggtcgccttcaccggc
gagaccaccaccggccggctgatcatgcagtacgcgtcgcagaacctgatcccggtgacg
ctggagctgggcggcaagtcgcccaacatcttcttcgaggatgtgctggctgccgacgac
gccttcttcgacaaggcgctggaaggctttgccatgttcgcgctgaaccagggcgaggtc
tgcacctgcccgtcgcgcgcgctgatccaggaatcgatctacgaccgcttcatggagcgc
gcgctcaagcgcgtggccgctatccgccagggccatccgctcgacaccggcaccatgatc
ggcgcgcaggcgtccgccgaacagctggagaagatcctgtcgtacatcgacctgggccgc
aaggaaggcgcacagtgcctcaccggcggcgagcgcaacgtgctggacggcgacctcgcg
ggcggctactacgtcaagccgaccgtgttcgccggccacaacaagatgcgcatcttccag
gaagagatcttcgggccggtggtatcggtgaccaccttcaaggatgaggaagaagcgctg
gccatcgccaacgacacgctctacgggctcggtgcgggtgtctggacacgtgacggcgcg
cgcgcattccgcatgggccgcggcatccaggcggggcgcgtgtggaccaactgctaccac
gcctaccccgcgcatgcggcattcgggggctacaagcagtccggcatcggccgcgagaac
catcgcatgatgctcgaccactaccagcagaccaagaacctgctggtgagctacagcccc
aacgcgctcgggttcttctga

DBGET integrated database retrieval system