KEGG   Cupriavidus necator H16: H16_B2352Help
Entry
H16_B2352         CDS       T00416                                 

Gene name
h16_B2352
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
reh  Cupriavidus necator H16
Pathway
reh03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:reh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    H16_B2352 (h16_B2352)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:reh03400]
    H16_B2352 (h16_B2352)
Enzymes [BR:reh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     H16_B2352 (h16_B2352)
DNA repair and recombination proteins [BR:reh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     H16_B2352 (h16_B2352)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: CAJ97134
UniProt: Q0JYP0
LinkDB All DBs
Position
2:2662859..2665591
Genome map
AA seq 910 aa AA seqDB search
MAKTTRPTAPKDPGKRRAAAKGAGKPTGKRASTARPAARGAPAAKAAPAALDKYRRMRDF
GATPEPSGAARTRGKVHKRAGELSFVIQKHAARRLHYDFRLELGGALKSWAVPKGPSLDP
ADKRMAIHVEDHPLDYAGFEGVIPAGHYGAGTVIVWDRGTWLPVGDAEAGYRAGKLKFEL
RGEKLHGHWTLVRMHGSRQKEQDAWLLIKERDETAVPASEFDVVEALPDSVLGGTQRKPA
AKRAKSAQPPDEAAPDAHGTAKSLKPPRGAPRAALPLALAPQLATLVEQPPSDAQAWRYE
IKFDGYRLLARIDGKDVRLFTRQGNDWTSKLRALARDVGTLGLPDGWLDGEIVVLGKHGA
TDFQALQNAFDTARVEGIQYFVFDLPYFAGHDLRKVPLVERRALLRRIFAHNTSPRLQFS
EDFEAGPADMLEAACRMKLEGVIGKRADAAYVSARTSTWIKLKCTLRQEFVVAGFTDPKG
SRAGIGSLLLGVHDSGGRLRYAGNVGTGFDARTLGALRTQLDALRADSAPFENVPAGVKG
HWVRPKLVAEVSFGSWTREGRVRHAVFHGLRTDKPARAVSVERPATPAANGKPAATTAKH
AGTRPKAAAKRTTAAGGKVAISHAERVIDTASGLTKGDLVRYYERAAPLILPHLRGRPIA
MVRAPSGVGGEQFFQRHSDTLRVDGLNVLDPGLWPGHPALLEIASAEALVAAAQLNVVEF
HTWNAGKRSIERPNRIVFDLDPGEGVPWPQMQEAAALMKALLDELGLASFLKTSGGKGLH
VVVPITPRAGWDEVKAFAHDAVRHVAATVPQRFVAKSGPSNRVGKIFIDYLRNGIGATTV
AAFSARARPGLGVSMPVWWEELDSLQGAAQWTVANAGPRLDAVAADDPWADYAETRQAIT
RAAARLARAR
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaccacgcgaccgacagcgccaaaggatcccggcaaacgccgcgccgcggca
aaaggcgccggcaagcccaccggcaagcgcgccagcacggcccgcccggcggcacgcggc
gcgccagccgccaaggccgctcccgccgcgctcgacaaataccgtcgcatgcgcgacttc
ggcgccacgcctgagcccagcggcgccgcgcgcacccgcggcaaggtgcacaagcgcgcc
ggcgagctttccttcgtgatccagaagcacgcggcgcgtcggctgcactatgactttcgc
ctcgaactcggcggcgcgctgaaaagctgggccgtgcccaaggggccgagcctggacccg
gccgacaagcgcatggccatccatgtcgaggaccatccgctggactatgccggcttcgag
ggcgtaatccccgccggccactatggcgccggcacggtcatcgtctgggaccgcggcacc
tggttgccggtaggcgatgccgaggccggctaccgcgccggcaagctgaagttcgagctg
cgcggtgaaaagctgcacggtcactggaccctggtgcgcatgcacggcagccggcagaag
gagcaggacgcctggctgctgatcaaggagcgcgacgagaccgccgtgccggcatcggag
ttcgatgtggtcgaggccttgccggacagcgtgctgggcggcacgcagcgcaaacccgcg
gcaaagcgcgcgaagtccgcgcagccgcctgacgaagccgcaccagatgcacacggcacg
gcgaaatccctgaagccgccgcgcggcgcgccgcgcgcggccttgccgctggcgctggcg
ccgcagctggccacgctggtggagcagcctccgtccgacgcgcaggcgtggcgctacgag
atcaagttcgacggctaccggctgctggcccgcatcgacggcaaggatgtgcgcctgttc
acgcgccagggcaacgactggaccagcaagctgcgtgcgctggcgcgcgacgtcggcacc
ctgggcctgcccgatggctggctcgatggcgagatcgtggtgctcggcaagcatggcgcg
accgacttccaggcgctgcagaatgccttcgataccgcgcgcgtcgagggcatccagtat
ttcgtgttcgacctgccctactttgccggccatgacctgcgcaaggtaccgctggtggag
cggcgcgccctgctgcgccggatcttcgcgcacaacacctcgccgcgcctgcagttcagc
gaggacttcgaggccggccctgccgacatgctcgaggcagcctgccgcatgaagcttgaa
ggcgtgatcggcaagcgcgccgacgccgcctatgtcagcgcgcgcaccagtacgtggatc
aagctgaaatgcaccttgcgccaggagttcgtggtggcgggcttcaccgacccgaagggc
agccgcgccggcatcggctcgttgctgcttggcgtgcacgacagcggcgggcggctgcgc
tacgcgggcaatgtcggcaccggcttcgacgcgcgcacgctgggcgcgctgcgcacgcag
ctggacgcgttgcgcgccgattccgcgccctttgagaacgtgcctgcaggcgtaaagggg
cactgggtgcggccaaagctggtggccgaggtctcgttcggcagctggacccgcgaaggc
cgcgtgcgccatgccgtgttccacggcctgcgcaccgacaagcccgcgcgcgcggtgtcg
gtggagcggccggcaacgccggcggccaacggcaagcccgcggcaaccacggcaaagcat
gccggcacacggccgaaggcggcggcaaagcgcaccaccgccgccggcggcaaggtcgcg
atcagccatgccgagcgcgtcatcgacacagcatccggcctgaccaagggcgacctggtg
cgctactacgaacgcgccgcgccgctgatcctgccgcacctgcgcgggcgaccgatcgcg
atggtgcgcgcgccatcgggcgtgggcggcgagcagttcttccagcggcatagcgacacg
ctgcgggtggacggcctcaacgtgctcgatccgggcctgtggcctgggcatcccgcgctg
ctggaaatcgcgtcggccgaagccctggtggccgcggcacagctcaatgtggtggagttc
cacacctggaacgccggcaagcgcagcatcgagcgccccaaccgcatcgtcttcgacctg
gacccgggcgaaggcgtgccctggccacaaatgcaggaagccgccgcgctgatgaaggcg
ctgctcgatgaactcggcctcgccagcttcctgaagaccagtggcggcaaggggctgcac
gtggtggtgccgatcacgccgcgtgccgggtgggacgaggtgaaggcgttcgcgcatgac
gcggtgcgccatgtcgccgccaccgtgccgcagcgcttcgtggccaagagcggtccaagc
aaccgcgttggcaagattttcatcgattacctgcgcaatggcataggcgccaccacggtg
gcggcattctcggcgcgggcacgcccggggctgggggtatcgatgccggtgtggtgggag
gaactcgatagcctgcaaggcgcggcgcagtggaccgtggccaatgccggcccgaggctc
gacgccgtggcggccgacgacccatgggcggactacgccgaaacccggcaggcgatcacg
cgcgccgcggcgcgactggcacgcgcccgatag

DBGET integrated database retrieval system