KEGG   Cupriavidus necator H16: PHG399Help
Entry
PHG399            CDS       T00416                                 

Gene name
fadD1
Definition
(GenBank) putative long-chain-fatty-acid-CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
reh  Cupriavidus necator H16
Pathway
reh00061  Fatty acid biosynthesis
reh00071  Fatty acid degradation
reh01100  Metabolic pathways
reh01212  Fatty acid metabolism
reh02024  Quorum sensing
Module
reh_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:reh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PHG399 (fadD1)
   00071 Fatty acid degradation
    PHG399 (fadD1)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PHG399 (fadD1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:reh01004]
    PHG399 (fadD1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:reh04147]
    PHG399 (fadD1)
Enzymes [BR:reh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     PHG399 (fadD1)
Lipid biosynthesis proteins [BR:reh01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   PHG399 (fadD1)
Exosome [BR:reh04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   PHG399 (fadD1)
  Exosomal proteins of breast cancer cells
   PHG399 (fadD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AAP86148
UniProt: Q7WWU3
LinkDB All DBs
Position
pHG1:complement(417947..419482)
Genome map
AA seq 511 aa AA seqDB search
MVASLQYGEARFDGAEIERRAAQVAGGLAALGVGEDDVVAIVLRNAPALFEITLACNRVG
AYHCPVDWRFTVDELGYILQDSGACVLFIEADLLATLRAAIPEGVRVLAVTPEPLALQAY
PTSRVTGEVPADVLRYEAWRSAQAAYSGPSHRPRGRFAYTSGTTGRPKGVRRLAQGLHPE
QPRLLRDTVKAVFDFSADARVYLSAPLYHGAPNLYGMQAMLATGLVVLDPRFDAEATLRA
IERHRITHLYLVPTMCVRLLALPQHVRNRYDLSSVRFVACTGAPFAVAIKQAMINWWGPV
INESYACSEMGMITVISSADAIRKPGSVGRPVSEAEVRIYSDAGCRLGTGGVGNIHVRQP
AYADFTYHNRPEARAAMDCEGLACVGDMGYVDADGFLFICDRKADMVISGGVNIYPAEIE
DALSGMPGVADCAAFGVPHEEFGEMVVAVVQPSDGTGLDPEEMRAWLKDRLAAYKVPKVI
ELRTELPRQESGKIHKRKLRDGYWQHAGRRI
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggtagcctcactgcaatatggcgaagcccggttcgacggcgctgagatcgaacgccgc
gccgcgcaggttgccggcggcctggctgccctgggcgtgggagaggacgatgtcgtggcc
atcgtgcttcgcaacgcgcccgcgctgttcgagatcacgctggcatgcaaccgcgtcggc
gcgtatcactgtccggtggactggcggttcaccgtggatgagctgggctatatcctgcag
gacagcggtgcctgtgtcctgttcatcgaggcggacctgttagcaacattgcgtgccgcg
atcccggaaggggtgcgcgtactggcggtcacgccagaaccgttggccttgcaggcttat
cccacttcgcgcgttaccggcgaagtgccggcagacgtccttcgctatgaagcatggcgc
agcgcacaggcggcgtacagcggtccgtcgcaccggccgcgcggacgcttcgcctatacc
tccggcactactggacgtccaaaaggcgtgcggcgcctcgcgcagggcctgcatccagag
cagccgcgcctgctgcgcgataccgtcaaggccgtgttcgatttttccgcggatgcgcgc
gtgtacctgtccgcgccgctgtatcacggcgcccccaatctctacggtatgcaggccatg
ctggcgaccgggctggtcgtgctggatccccgcttcgatgccgaagccacgctgcgcgcc
atcgagcgccatcgcatcacgcacctgtacctggtgcccaccatgtgcgtacgcctgctg
gcgttgccgcaacacgtacgcaaccgctacgacctgtcgtccgtgcgcttcgtcgcctgt
acaggcgcgccctttgccgttgccatcaagcaggccatgatcaattggtgggggccagtg
atcaacgaatcgtatgcgtgcagcgaaatgggcatgatcaccgtgatttcgtccgcggac
gccatccgcaagcccgggtcggtcggccggcctgtgagcgaggccgaggtgcgcatctac
agcgacgcgggctgccgcctcggcacaggaggggttggcaacatccatgtgcgccagcct
gcttatgcggactttacctaccacaatcgccctgaggcgcgcgccgcgatggattgcgaa
ggactggcgtgcgtaggcgacatgggctacgtggatgccgacggcttcctgttcatctgc
gaccgcaaggccgatatggtgatctccggcggtgtgaacatctacccggccgaaatcgaa
gacgcgctgtccggcatgccgggcgtggcggactgcgcggcgtttggcgtgccccacgaa
gagtttggcgaaatggtcgtggcagtagtacagccctctgacggcacgggattggatccg
gaggaaatgcgtgcgtggctgaaagaccggctcgccgcttacaaggtgccgaaggtgatc
gaactgcgcaccgaactgccgcgccaggaaagcggaaagatacacaagcgcaagctgcgc
gatggctactggcagcatgccgggcgcaggatctga

DBGET integrated database retrieval system