KEGG   Ralstonia eutropha H16: PHG426Help
Entry
PHG426            CDS       T00416                                 

Gene name
cbbSp
Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00630  Glyoxylate and dicarboxylate metabolism
reh00710  Carbon fixation in photosynthetic organisms
reh01100  Metabolic pathways
reh01120  Microbial metabolism in diverse environments
reh01200  Carbon metabolism
Module
reh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
reh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PHG426 (cbbSp)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PHG426 (cbbSp)
Enzymes [BR:reh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     PHG426 (cbbSp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AAP86175
UniProt: Q59102
LinkDB All DBs
Position
pHG1:complement(448586..449005)
Genome map
AA seq 139 aa AA seqDB search
MRITQGTFSFLPDLTDAQITSQLEYCLNQGWAVGIEYTDDPHPRNTYWEMFGLPMFDLRD
AAGILLEINNARSTFPNHYIRVTAFDSTHTVESVVMSFIVNRPADEPGFRLVRQEEPGRT
IRYSIESYAVQARPEGSRY
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattactcaaggcactttctctttcctgcccgacctcaccgacgcgcagatcacc
agccagcttgaatactgcctgaaccagggctgggcggtcggcatcgagtacaccgacgac
ccgcatccgcgcaatacctactgggagatgttcggcctgccgatgttcgacctgcgcgat
gccgccggcatcctgctggagatcaacaacgcgcgcagcaccttccccaaccactacatc
cgcgtcacggccttcgattcgacgcatacggtggagtcggtggtgatgtcgttcatcgtg
aatcgtccggccgacgagcccggcttccgcctggtgcgccaggaagagcccggccgcacg
atccgctattcgatcgagagctacgccgtgcaggcgcgccccgagggcagccgctactga

DBGET integrated database retrieval system