KEGG   Ralstonia eutropha H16: PHG427Help
Entry
PHG427            CDS       T00416                                 

Gene name
cbbLp
Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00630  Glyoxylate and dicarboxylate metabolism
reh00710  Carbon fixation in photosynthetic organisms
reh01100  Metabolic pathways
reh01120  Microbial metabolism in diverse environments
reh01200  Carbon metabolism
Module
reh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
reh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PHG427 (cbbLp)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PHG427 (cbbLp)
Enzymes [BR:reh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     PHG427 (cbbLp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AAP86176
UniProt: P42721
LinkDB All DBs
Structure
PDB: 

Position
pHG1:complement(449063..450523)
Genome map
AA seq 486 aa AA seqDB search
MNAPESVQAKPRKRYDAGVMKYKEMGYWDGDYEPKDTDLLALFRITPQDGVDPVEAAAAV
AGESSTATWTVVWTDRLTACDMYRAKAYRVDPVPNNPEQFFCYVAYDLSLFEEGSIANLT
ASIIGNVFSFKPIKAARLEDMRFPVAYVKTFAGPSTGIIVERERLDKFGRPLLGATTKPK
LGLSGRNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLFVMDAVNKASAATGEVKG
SYLNVTAGTMEEMYRRAEFAKSLGSVVIMIDLIVGWTCIQSMSNWCRQNDMILHLHRAGH
GTYTRQKNHGVSFRVIAKWLRLAGVDHMHTGTAVGKLEGDPLTVQGYYNVCRDAYTHTDL
TRGLFFDQDWASLRKVMPVASGGIHAGQMHQLIHLFGDDVVLQFGGGTIGHPQGIQAGAT
ANRVALEAMVLARNEGRDILNEGPEILRDAARWCGPLRAALDTWGDISFNYTPTDTSDFA
PTASVA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacctgaatcggtccaagccaagccgcgcaagcgctatgacgccggcgtcatg
aagtacaaggaaatggggtactgggacggcgactacgagcccaaggataccgacctgctg
gcgctgttccgcatcacgccgcaagacggcgtggatccggtcgaggccgctgccgcggtg
gccggcgaatcctccaccgccacctggacggtggtgtggaccgaccgcctgaccgcctgc
gacatgtaccgcgccaaggcctaccgggtcgatccggtgcccaacaaccccgagcagttc
ttctgctacgtggcctatgacctgtcgctgttcgaggaaggctcgatcgccaacctgacc
gcgtcgatcatcggcaacgtcttcagcttcaagccgatcaaggccgcgcgcctggaagac
atgcgcttcccggtggcctatgtgaagaccttcgccggcccctccacgggcatcatcgtc
gagcgcgagcgcctcgacaagttcggccgcccgctgctgggcgcgaccaccaagcccaag
ctgggactgtcgggccgcaactacggccgcgtggtgtatgagggcctgaagggcgggctg
gatttcatgaaggacgacgagaacatcaactcgcagcccttcatgcactggcgcgaccgc
ttcctgttcgtgatggacgccgtcaacaaggcttcggccgccaccggcgaggtcaagggc
agctacctcaacgtgaccgccggcaccatggaagagatgtaccggcgcgccgagttcgcc
aagtcgctgggctcggtcgtcatcatgatcgacctgatcgtgggctggacctgtatccag
tccatgagcaactggtgccgccagaacgacatgatcctgcacctgcaccgcgcgggccat
ggcacctacacccggcagaagaaccacggcgtgtccttccgcgtgatcgccaaatggctg
cgcctggccggcgtcgaccacatgcacaccggcaccgcggtgggcaagctggaaggcgat
ccgctgaccgtgcagggctactacaacgtctgccgcgatgcgtacacccataccgacctg
acgcgcgggctgttcttcgaccaggactgggcttcgctgcgcaaggtgatgccggtggcc
tccggcggcatccatgccggccagatgcaccagctgatccacctctttggcgacgacgtg
gtgctgcagttcggcggcggcaccatcggccacccgcaagggatccaggcgggtgctacg
gccaaccgcgtggcgctggaagcgatggtgctggcgcgcaacgaaggccgcgacatcctc
aatgaagggccggagatcctgcgcgatgccgcgcgctggtgcggaccgctgcgggctgcg
ctcgatacctggggcgatatcagcttcaactacacgccgaccgacacctcggacttcgcg
cccaccgcgtcggtggcctga

DBGET integrated database retrieval system