KEGG   Rhizobium sp. IE4771: IE4771_CH01720Help
Entry
IE4771_CH01720    CDS       T03310                                 

Gene name
tuf-1
Definition
(GenBank) elongation factor Tu 1
  KO
K02358  elongation factor Tu
Organism
rei  Rhizobium sp. IE4771
Brite
Translation factors [BR:rei03012]
 Eukaryotic Type
  Elongation factors
   IE4771_CH01720 (tuf-1)
 Prokaryotic Type
   IE4771_CH01720 (tuf-1)
Mitochondrial biogenesis [BR:rei03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    IE4771_CH01720 (tuf-1)
Exosome [BR:rei04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   IE4771_CH01720 (tuf-1)
  Exosomal proteins of breast cancer cells
   IE4771_CH01720 (tuf-1)
  Exosomal proteins of colorectal cancer cells
   IE4771_CH01720 (tuf-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AIC26851
UniProt: A0A060I5R0
LinkDB All DBs
Position
1726381..1727556
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPARHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYDFPGDDIPVVKGSALAALEDSDKK
IGEDAIRELMAAVDSYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALVRGVNRDGVERGQILCKPGSVKPHK
KFMAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVAVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagtaagtttgagcgcaacaagccgcacgtcaacattggcacgatcggccac
gttgaccacggcaagacgtctctgacggcagcgatcacgaagtacttcggtgagttcaag
gcgtacgaccagatcgacgcggctccggaagagaaggcgcgcggcatcacgatttcgacg
gcgcacgtcgaatatgagacgccggcccgccactacgcgcacgtcgactgccccggccat
gccgactacgtcaagaacatgatcaccggtgctgcccagatggacggcgcgatcctggtg
tgctcggctgctgacggcccgatgccgcagacgcgcgaacacattctgctggcccgccag
gtcggcgttccggcgatcgtcgtgttcctgaacaaggtcgaccaggttgacgacgccgag
cttctcgagctggttgagctcgaagttcgcgaactgctgtcgtcctacgacttcccgggc
gacgacatcccggtcgtcaagggttcggcgcttgccgctcttgaagatagcgacaagaag
atcggcgaagacgcgatccgcgagctgatggcagcggtcgactcctacatcccgacgcct
gagcgtccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctccggc
cgcggcactgtcgtaaccggccgcgtcgagcgtggcattgtcaaggttggcgaagaagtc
gagatcgtcggcatccgtccgacctcgaagacgacggtcaccggcgttgaaatgttccgc
aagctgctcgaccagggccaggccggcgacaacatcggcgcgctggttcgcggtgtgaac
cgtgacggcgtcgagcgtggccagatcctgtgcaagccgggttcggtcaagccgcacaag
aagttcatggctgaagcctacatcctgacgaaggaagagggcggccgtcatacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgactgatgtgaccggcatcgtcacg
ctgccggaaggcacggaaatggtcatgccgggcgacaacgtcacggttgccgtcgagctg
atcgttccgatcgcgatggaagaaaagctgcgcttcgccatccgcgaaggcggccgcacc
gtcggcgccggtatcgtcgcctcgatcgtcgagtaa

DBGET integrated database retrieval system