KEGG   Rhizobium sp. IE4771: IE4771_CH02067Help
Entry
IE4771_CH02067    CDS       T03310                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rei  Rhizobium sp. IE4771
Pathway
rei00010  Glycolysis / Gluconeogenesis
rei00020  Citrate cycle (TCA cycle)
rei00620  Pyruvate metabolism
rei01100  Metabolic pathways
rei01110  Biosynthesis of secondary metabolites
rei01120  Microbial metabolism in diverse environments
rei01130  Biosynthesis of antibiotics
rei01200  Carbon metabolism
Module
rei_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IE4771_CH02067 (pdhC)
   00020 Citrate cycle (TCA cycle)
    IE4771_CH02067 (pdhC)
   00620 Pyruvate metabolism
    IE4771_CH02067 (pdhC)
Enzymes [BR:rei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     IE4771_CH02067 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 QRPTase_N HlyD_2 DUF2118
Motif
Other DBs
NCBI-ProteinID: AIC27177
UniProt: A0A060I042
LinkDB All DBs
Position
2035600..2036943
Genome map
AA seq 447 aa AA seqDB search
MPINITMPALSPTMEEGNLSKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKLV
VAAGTEGVKVNALIAVLAADGEDVAAAASGAGSAAPAKAEAAPAPKAEAAPAKAGPAPAA
APPAAVSAGGNRTFSSPLARRLAREAGIDLSAVAGSGPHGRVVKSDVEAAVAGGGAKAAP
APAAAAPQAAAAPAPAAAAPKGASEEAVLKLFEPGSYELVPHDGMRKTIARRLVESKQTI
PHFYVSVDCELDALMALRAQLNDAAPRKDNAPAYKLSVNDMVIKAMALALRDVPDANVSW
TDSNMVKHKHADVGVAVSIPGGLITPIIRKAEQKTLSVISNEMRDLGKRAKDRKLKPEEY
QGGTSSVSNMGMMGVKNFAAVVNPPHATILAVGAGEQRVVVKNGEMAIATVMSVTLSTDH
RCVDGALGAELLQAFKGYIENPMGMLV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaatatcacgatgcccgccctctctccgaccatggaagaaggcaatctttcc
aagtggctggtcaaggaaggcgacaaggtcaagtctggcgatgtgatcgccgagatcgag
accgacaaggcgacgatggaagtcgaagccgtcgatgaaggcacggtcgccaagctcgtc
gttgccgccggcaccgaaggtgtcaaggtcaatgcgctgatcgccgttcttgccgctgac
ggcgaagatgtcgccgctgccgcaagcggcgccggctccgccgctccggcgaaggctgaa
gccgcaccggcaccgaaggccgaggctgcaccggcgaaggctgggcccgctccggctgct
gcgccacccgcggcagtttcagccggtggcaaccgcaccttctcttcgccgctcgctcgc
aggctcgcgagggaagccggcatcgacctttcggcggtcgcaggctcgggcccgcatggc
cgcgtcgtcaagagcgatgtcgaagccgccgttgccggcggtggcgccaaggctgcgccc
gcaccggctgctgctgctccgcaggccgccgcggctccggctccggccgccgcagcgccg
aagggcgcttccgaggaagccgtgctcaagctcttcgagccgggttcctacgagctcgtg
ccgcatgacggcatgcgcaagacgatcgcccggcgcctggtcgaatccaagcagacgatc
ccgcatttctatgtcagcgtcgattgcgagctcgacgcactgatggcgctacgcgcccag
ctgaacgatgcggcgccccgcaaggacaacgctccggcctataagctctcggtcaacgac
atggtcatcaaggccatggcgctggcgttgcgcgatgtccccgacgccaacgtgtcgtgg
accgacagcaacatggtcaagcacaagcatgccgatgtcggcgtcgccgtctcgatcccc
ggcggcctgatcaccccgatcatccgcaaggccgagcagaagacgctgtccgtcatctcc
aacgagatgcgcgatctcggcaagcgggccaaggaccgcaagctgaagccggaggaatat
cagggcggcaccagctcggtctccaacatgggcatgatgggcgtcaagaacttcgccgcc
gtcgtcaacccgccgcatgcgacgatcctggcggtcggcgccggcgagcagcgggtcgtc
gtcaagaacggcgaaatggcgatcgccacggtcatgagcgtcacactgtcgaccgaccat
cgctgcgtcgacggcgcgctgggcgccgagctgctccaggccttcaagggctacatcgaa
aacccgatgggcatgcttgtctga

DBGET integrated database retrieval system