KEGG   Rhizobium sp. IE4771: IE4771_CH02401Help
Entry
IE4771_CH02401    CDS       T03310                                 

Gene name
treS-1
Definition
(GenBank) trehalose synthase 1
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rei  Rhizobium sp. IE4771
Pathway
rei00500  Starch and sucrose metabolism
rei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    IE4771_CH02401 (treS-1)
Enzymes [BR:rei01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     IE4771_CH02401 (treS-1)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     IE4771_CH02401 (treS-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AIC27506
UniProt: A0A060I7I0
LinkDB All DBs
Position
2377006..2378667
Genome map
AA seq 553 aa AA seqDB search
MINDLWYKNAVIYCLSVETFMDANGDGVGDFQGLMRRLDYLSGLGVTAIWLMPFQASPGR
DDGYDVSDYYNVDRRYGSLGDFVEFTHGAKQRGIRVLIDLVINHTSKDHPWFRDARSDPH
SRYREWYVWSDKKPANADQGMVFPGVQKTTWTYDEKAKAYYFHRFYDHQPDLNTSNPEVQ
AEILKIMGFWIQLGVSGFRMDAAPFIIATKGAEVTKPVEQFDMLRKFREFLQWRLGDSIV
LAEANILPKDNFEYFGDDGDRMQMMFNFQVNQTLFYALATADTRPLKKAMEATKPRPATA
QWGLFLRNHDELDLGRLTDKQRNAVFAAFGPERDMQLYDRGIRRRLAPMLGGDRRRIEMA
YSLLFSLPGTPVIRYGDEIGMGDDLCLPERNCARTPMQWSTEPEGGFTKSQKPISPVIKD
GPYGFEHINVAVQRRDPNSLLNWTERMIRMRKEAPEIGWGDFSAVDTGDDGVLALRYDWR
GNSVLILHNLHPHPSEVSFDPDVGEQGRKLIDIAEGASSEADDKGCHKVMLDAYGYRWYR
VGGLDYLLRRKDI
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgacctctggtacaaaaacgccgtcatatactgcctgtccgtcgagaccttc
atggatgcgaacggtgacggcgtcggcgattttcagggactgatgcgccgtctcgactat
ctctccggcctcggcgtgacggcgatctggctgatgccgtttcaggcgtctccgggtcgt
gacgacggttacgacgtctccgactattacaatgtcgaccggcgctacggttcgctcggc
gatttcgtcgaattcacacacggcgccaagcagcgcggcatccgggtgctgatcgatctg
gtgatcaatcacacctcgaaggatcatccctggtttcgggacgccagaagcgatccgcat
tcgcgctatcgtgaatggtacgtctggtcggacaaaaagcctgcgaatgcggatcaaggc
atggttttccctggcgtccagaagaccacctggacctatgacgaaaaagccaaggcctac
tatttccaccgcttctacgatcaccagcccgatctcaacacctccaacccagaggtccag
gcggagatcctcaagatcatgggcttctggatccagctcggtgtttcgggcttccgcatg
gacgccgcccccttcatcattgccacgaagggcgccgaggtcaccaagccggtcgagcag
ttcgacatgctgcggaagtttcgcgagttcctgcaatggcgcctgggcgactccatcgtg
ctggcggaggccaatatcctgccgaaggataatttcgaatatttcggcgacgatggcgac
cgcatgcagatgatgttcaatttccaggtcaaccagacgctgttctatgcgctcgccacg
gccgatacccgcccgctgaagaaggcgatggaggccaccaagccgcgcccggcaactgcc
caatgggggctgtttcttcgcaaccacgatgaattggatctcggtcgtctgacggataag
cagcgcaacgcagtatttgccgcgttcggacccgagagggacatgcagctttatgacaga
ggcattcgtcgtcgcctggcgcccatgcttggcggcgaccggcgcaggatcgagatggcc
tacagcctgctattctcgctgcccggaactccagtcatccgctacggcgatgaaatcggc
atgggcgatgatttgtgcctgccggagcgcaactgcgcgcgcaccccgatgcaatggtcg
acggagccggaaggcggcttcaccaaaagccaaaaacccatttcgccggtcatcaaggat
ggtccctacggcttcgaacatatcaacgtcgccgtccagcggcgcgatccgaactcgctt
ctgaattggaccgagcgaatgatccgaatgcgcaaggaggctcccgaaatcggttggggc
gatttctcggcggtcgacacaggcgacgacggcgtactggcgctgcggtatgactggcgc
ggcaattcggtgctgatcctgcacaacctacatccgcacccgtcggaagtaagtttcgat
cccgatgtcggtgaacaggggcgaaagttgattgatatcgccgagggtgcgagcagcgag
gcggacgacaaagggtgccataaggtcatgctcgatgcctatggctatcgttggtatcgc
gtcggcggtctcgactatctcctcaggcggaaggacatttag

DBGET integrated database retrieval system