KEGG   Rhizobium sp. IE4771: IE4771_CH02449Help
Entry
IE4771_CH02449    CDS       T03310                                 

Definition
(GenBank) glutathione S-transferase/acetyltransferase fusion protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rei  Rhizobium sp. IE4771
Pathway
rei00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rei00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    IE4771_CH02449
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rei02000]
    IE4771_CH02449
Enzymes [BR:rei01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     IE4771_CH02449
Transporters [BR:rei02000]
 Other Transporters
  Pores ion channels [TC:1]
   IE4771_CH02449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_CG GST_N_4 GST_C_2 GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: AIC27553
UniProt: A0A060HX85
LinkDB All DBs
Position
2424191..2425348
Genome map
AA seq 385 aa AA seqDB search
MTATVRPLEPSDRTAWEPLWEAYQRFYEVVIPGETTDLTWTRFHDPDELMHALGAFDEDG
RLVGIVHAIFHRSCWLPQWTCYLQDLYVADSQRGLGTGAALIDAVADFARARRRQALLDD
ARNECHGAAAVRPDRRTLRLHPVSQSSLTIGLAQRPCRAIDSGRRQCLTERQQEEDVMAE
ELVFYTNPMSRGRIARWMLEEIGQPYRTELLTFGETMKAPEYLSVNPMGKVPAIRHGNTV
VTECAAICAYLAETFPEKGLAPRPEERARYYRWMFFAAGPLESAVTMKALGFEIPTERLR
MAGCGGFGDVMNTLEMAVSGSTYVTGERFTAADVYVGAHIGWGLGFGSIEKRQAFVDYFG
RVSEREAYKRANALDDEAGKTMQAA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgaccgtgcgcccgctcgaaccttctgaccgcaccgcttgggagcccctatgg
gaggcgtatcagcgcttctacgaggtagtcatccctggcgaaaccacggatctcacctgg
acccgcttccacgatcctgacgaattgatgcacgcgctcggcgcctttgacgaagacggc
cgcctcgtcggcattgtgcatgcgatctttcaccgctcctgctggctgccgcaatggacc
tgctatctgcaggatctctatgtcgccgatagccagcgcggcctcggcaccggtgccgca
ctgatcgatgcggtcgccgattttgcgcgcgcacggcgcaggcaggctctactggatgac
gcacgaaacgaatgccacggcgcggcggctgtacgaccggatcgccgaacgctcaggctt
catccagtatcgcaaagctctctgacgatcggacttgcacaaagaccttgccgcgctatt
gattccgggcgacggcaatgcctgacagaacggcaacaggaggaggatgtcatggccgaa
gagttggtattctatacaaacccgatgtcacgcgggcgcatcgcgcgctggatgctggag
gaaatcggtcagccctatcgcaccgaactcctgaccttcggcgaaactatgaaggcgccg
gaatatctttccgtcaacccgatgggcaaggtgccggcaatccgccacggcaacacagtg
gtcaccgaatgcgcggcaatctgcgcctacctcgccgagaccttcccggaaaaggggctg
gccccaagaccggaggagcgcgcccgctattaccgctggatgttctttgccgccggtccg
ctggaatcggcggtgacgatgaaggcgctcggtttcgaaattccgacggagcgcctgcga
atggccggctgcggcggttttggcgacgtcatgaacacgctcgaaatggccgtttccggc
tcgacctatgtcaccggcgagcgcttcaccgccgccgacgtctatgtcggcgctcatatc
ggctggggcctcggcttcggctccatcgagaaacgtcaggccttcgtcgattacttcggc
cgcgtcagcgagcgcgaagcctataagcgcgccaatgcactggacgacgaggccggcaag
acgatgcaggcggcctga

DBGET integrated database retrieval system