KEGG   Rhizobium sp. IE4771: IE4771_CH02889Help
Entry
IE4771_CH02889    CDS       T03310                                 

Definition
(GenBank) ABC transporter permease protein
  KO
K02011  iron(III) transport system permease protein
Organism
rei  Rhizobium sp. IE4771
Pathway
rei02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rei00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    IE4771_CH02889
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rei02000]
    IE4771_CH02889
Transporters [BR:rei02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    IE4771_CH02889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AIC27984
UniProt: A0A060I2N3
LinkDB All DBs
Position
complement(2855348..2857042)
Genome map
AA seq 564 aa AA seqDB search
MPGYVRAGNSQPAWLFPFIVITVLILSVLPLARLAMAGIAGFASGGVTDVLADPALWQAT
YYTVVTSVLGTIVSLLIGCLFAFLLTLTDIPGKGLLSFFFVLPMMIPPQVTALAWVQMSG
PSSPLLKALAIAPPLGSPQPLYSVGGIALLYGVQHAPLVYLALRAGLMTLPRDGVEAARL
SGASSFRVFRDIILPLSLPGIIAGAAISFVSCTGNFGIPAILGIPASIFTLPTLIFTKFS
AFTSRTFGDVAVLSAIIAMISVAGLMIQDRALRGRDYRVIGLSGASAAFELGAWRFAFTP
LLWAILFFMLAAPFFALVAGALVPAYGVPLTFKTMSLHAFDEILFRQAVTRTAFVNSISL
AGATAVCLLVVTVLAAYMLTRRKDAASHLIASLIEIPYSLPGIVMAVAFILVFAAPIPFF
HISLYGTIWIILIAYFSSFFAVSLKPVVSAFHQLDPALEEAARLSGAGFFRRLADIIVPL
IAPAAGASVILVFLIACNELTISALLWSAGTQTLGVAIYNLDDSGSSDLASALSVLVVLM
VVVMMLLLELLAKHLPKGVVPWRN
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgccaggctatgtcagagcaggaaacagccagcccgcctggctgtttccttttatcgtc
attaccgtgctcatcctcagcgtgctgccgctcgcccgccttgccatggcagggatcgcg
ggcttcgccagcggcggtgtcaccgatgtgctcgccgacccggcgctctggcaggccacc
tattacaccgtcgtcacctccgttctcggcacgatcgtttcgctcctcatcggctgcctc
ttcgccttcctgctgacgctgaccgacatcccgggtaaggggctgctcagcttcttcttc
gtgctgccgatgatgatcccgccgcaggtgacggcactcgcttgggtgcagatgtcgggg
ccgtcgagcccgctgctgaaggcgctcgccatcgctccgccgctcggctcgccgcagccg
ctctattccgtcggcggcatcgcgctgctctatggagtgcagcatgcgccgctggtctat
ctcgcgctcagggccgggctgatgacgctgccgcgtgacggcgtggaggccgcacggctt
tccggcgcctccagctttcgagtcttccgcgacatcatcctgcctctgtcgctgcccggc
atcattgcgggggcggcgatctccttcgtctcctgcaccggcaatttcggcatccccgcc
attctcggcattcccgcctcgatcttcacgctgccgacgttgattttcaccaagttttcc
gccttcaccagccgcaccttcggcgatgtcgccgtgctctcggcgatcatcgcgatgatc
tcggtggcgggcttgatgatccaggaccgggcgctcagaggccgcgattaccgcgtcatc
ggcctgtcgggggcgagcgccgccttcgagctcggcgcctggcggttcgccttcacgccg
ctcctctgggcgatcctgttcttcatgctcgccgcacccttcttcgcgctcgtcgccggc
gcgctggttcccgcctacggcgtgccgctcaccttcaagaccatgtcgctgcatgccttt
gacgagatcctcttccggcaggcggtgacgcgcacggctttcgtcaactcgatctcgctt
gcaggcgccaccgctgtctgtctcctggtggtgaccgtgcttgcggcctatatgctaacg
cggcgaaaggatgcggcgtcccacctcatcgccagcctgatcgagataccttattcgctg
cccggtatcgtcatggcggtcgccttcatcctggtcttcgccgcgcccatccccttcttc
cacatctcgctctacggcacgatctggatcattctcattgcctatttctcttccttcttc
gccgtcagcctgaaacccgtggtcagcgcctttcaccagctcgatccggcgctggaggag
gcagcacgtctttccggcgccggcttctttcgaaggcttgccgatatcatcgtgccgctg
attgcgcccgccgccggcgcttccgtcatcctcgtcttcctgattgcctgcaacgagctg
acgatctccgcgctgctctggtcggccggcacccagacgctcggtgtcgccatctacaat
ctcgatgacagcggcagctccgatcttgcctcggcgctgtcggtgctcgtcgtcctcatg
gtcgtcgtcatgatgctgctcttggaactcctggcgaaacacttgccgaaaggggtggtc
ccatggcgaaactga

DBGET integrated database retrieval system